Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2569618..2570256 | Replicon | chromosome |
Accession | NZ_CP122588 | ||
Organism | Escherichia coli strain ETEC6335 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | QDY30_RS12555 | Protein ID | WP_000813794.1 |
Coordinates | 2570080..2570256 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QDY30_RS12550 | Protein ID | WP_001270286.1 |
Coordinates | 2569618..2570034 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDY30_RS12530 (2564770) | 2564770..2565711 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
QDY30_RS12535 (2565712) | 2565712..2566725 | - | 1014 | WP_134795749.1 | ABC transporter ATP-binding protein | - |
QDY30_RS12540 (2566743) | 2566743..2567888 | - | 1146 | WP_119458051.1 | ABC transporter substrate-binding protein | - |
QDY30_RS12545 (2568133) | 2568133..2569539 | - | 1407 | WP_000760666.1 | PLP-dependent aminotransferase family protein | - |
QDY30_RS12550 (2569618) | 2569618..2570034 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
QDY30_RS12555 (2570080) | 2570080..2570256 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
QDY30_RS12560 (2570478) | 2570478..2570708 | + | 231 | WP_000494244.1 | YncJ family protein | - |
QDY30_RS12565 (2570800) | 2570800..2572761 | - | 1962 | WP_119458050.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
QDY30_RS12570 (2572834) | 2572834..2573370 | - | 537 | WP_000429152.1 | DNA-binding transcriptional regulator SutR | - |
QDY30_RS12575 (2573462) | 2573462..2574637 | + | 1176 | WP_062883094.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2574677..2575825 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T277244 WP_000813794.1 NZ_CP122588:c2570256-2570080 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT277244 WP_001270286.1 NZ_CP122588:c2570034-2569618 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|