Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 762231..763068 | Replicon | chromosome |
Accession | NZ_CP122588 | ||
Organism | Escherichia coli strain ETEC6335 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A7U9LL67 |
Locus tag | QDY30_RS03735 | Protein ID | WP_000854687.1 |
Coordinates | 762688..763068 (+) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | QDY30_RS03730 | Protein ID | WP_012816826.1 |
Coordinates | 762231..762599 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDY30_RS03695 (758418) | 758418..759095 | + | 678 | WP_024226808.1 | hypothetical protein | - |
QDY30_RS03700 (759111) | 759111..759521 | + | 411 | WP_000848829.1 | hypothetical protein | - |
QDY30_RS03705 (759741) | 759741..760562 | + | 822 | WP_001234566.1 | DUF932 domain-containing protein | - |
QDY30_RS03710 (760562) | 760562..760807 | + | 246 | WP_000680588.1 | hypothetical protein | - |
QDY30_RS03715 (760901) | 760901..761374 | + | 474 | WP_001364892.1 | antirestriction protein | - |
QDY30_RS03720 (761390) | 761390..761866 | + | 477 | WP_001364966.1 | RadC family protein | - |
QDY30_RS03725 (761935) | 761935..762156 | + | 222 | WP_000692340.1 | DUF987 domain-containing protein | - |
QDY30_RS03730 (762231) | 762231..762599 | + | 369 | WP_012816826.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QDY30_RS03735 (762688) | 762688..763068 | + | 381 | WP_000854687.1 | TA system toxin CbtA family protein | Toxin |
QDY30_RS03740 (763065) | 763065..763553 | + | 489 | WP_001054227.1 | DUF5983 family protein | - |
QDY30_RS03745 (763573) | 763573..763770 | + | 198 | WP_000772026.1 | DUF957 domain-containing protein | - |
QDY30_RS03750 (763855) | 763855..764700 | + | 846 | WP_001274558.1 | DUF4942 domain-containing protein | - |
QDY30_RS03760 (765000) | 765000..765506 | + | 507 | WP_000228930.1 | G/U mismatch-specific DNA glycosylase | - |
QDY30_RS03765 (765585) | 765585..767426 | - | 1842 | WP_000437371.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 14199.13 Da Isoelectric Point: 6.8615
>T277235 WP_000854687.1 NZ_CP122588:762688-763068 [Escherichia coli]
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFSDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGVPSQLINSIDILRARRATGLMTRDNYRTVNNITLGRHPEEAKQ
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFSDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGVPSQLINSIDILRARRATGLMTRDNYRTVNNITLGRHPEEAKQ
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|