Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4107618..4108237 Replicon chromosome
Accession NZ_CP122587
Organism Klebsiella pneumoniae strain NCRE-61

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag QDV36_RS24690 Protein ID WP_002892050.1
Coordinates 4108019..4108237 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag QDV36_RS24685 Protein ID WP_002892066.1
Coordinates 4107618..4107992 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDV36_RS24675 (QDV36_24685) 4102770..4103963 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
QDV36_RS24680 (QDV36_24690) 4103986..4107132 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
QDV36_RS24685 (QDV36_24695) 4107618..4107992 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
QDV36_RS24690 (QDV36_24700) 4108019..4108237 + 219 WP_002892050.1 HHA domain-containing protein Toxin
QDV36_RS24695 (QDV36_24705) 4108396..4108962 + 567 WP_002892030.1 maltose O-acetyltransferase -
QDV36_RS24700 (QDV36_24710) 4108934..4109074 - 141 WP_004147370.1 hypothetical protein -
QDV36_RS24705 (QDV36_24715) 4109095..4109565 + 471 WP_002892026.1 YlaC family protein -
QDV36_RS24710 (QDV36_24720) 4109540..4110991 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
QDV36_RS24715 (QDV36_24725) 4111092..4111790 + 699 WP_002892021.1 GNAT family protein -
QDV36_RS24720 (QDV36_24730) 4111787..4111927 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
QDV36_RS24725 (QDV36_24735) 4111927..4112190 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T277228 WP_002892050.1 NZ_CP122587:4108019-4108237 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT277228 WP_002892066.1 NZ_CP122587:4107618-4107992 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References