Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4107618..4108237 | Replicon | chromosome |
Accession | NZ_CP122587 | ||
Organism | Klebsiella pneumoniae strain NCRE-61 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | QDV36_RS24690 | Protein ID | WP_002892050.1 |
Coordinates | 4108019..4108237 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | QDV36_RS24685 | Protein ID | WP_002892066.1 |
Coordinates | 4107618..4107992 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDV36_RS24675 (QDV36_24685) | 4102770..4103963 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QDV36_RS24680 (QDV36_24690) | 4103986..4107132 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
QDV36_RS24685 (QDV36_24695) | 4107618..4107992 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
QDV36_RS24690 (QDV36_24700) | 4108019..4108237 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
QDV36_RS24695 (QDV36_24705) | 4108396..4108962 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
QDV36_RS24700 (QDV36_24710) | 4108934..4109074 | - | 141 | WP_004147370.1 | hypothetical protein | - |
QDV36_RS24705 (QDV36_24715) | 4109095..4109565 | + | 471 | WP_002892026.1 | YlaC family protein | - |
QDV36_RS24710 (QDV36_24720) | 4109540..4110991 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
QDV36_RS24715 (QDV36_24725) | 4111092..4111790 | + | 699 | WP_002892021.1 | GNAT family protein | - |
QDV36_RS24720 (QDV36_24730) | 4111787..4111927 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
QDV36_RS24725 (QDV36_24735) | 4111927..4112190 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T277228 WP_002892050.1 NZ_CP122587:4108019-4108237 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT277228 WP_002892066.1 NZ_CP122587:4107618-4107992 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |