Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
Location | 4139..4719 | Replicon | plasmid pNCRE-61-15.0 |
Accession | NZ_CP122585 | ||
Organism | Klebsiella pneumoniae strain NCRE-61 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A060VNB1 |
Locus tag | QDV36_RS04130 | Protein ID | WP_001136729.1 |
Coordinates | 4139..4453 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2X1PRM1 |
Locus tag | QDV36_RS04135 | Protein ID | WP_000093040.1 |
Coordinates | 4441..4719 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDV36_RS04110 (QDV36_04105) | 2547..2777 | + | 231 | WP_231828916.1 | hypothetical protein | - |
QDV36_RS04115 (QDV36_04110) | 2784..3314 | + | 531 | WP_065521056.1 | hypothetical protein | - |
QDV36_RS04120 (QDV36_04115) | 3342..3521 | - | 180 | WP_065521055.1 | Rop family plasmid primer RNA-binding protein | - |
QDV36_RS04125 (QDV36_04120) | 3547..3975 | - | 429 | WP_001140599.1 | hypothetical protein | - |
QDV36_RS04130 (QDV36_04125) | 4139..4453 | - | 315 | WP_001136729.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QDV36_RS04135 (QDV36_04130) | 4441..4719 | - | 279 | WP_000093040.1 | CopG family ribbon-helix-helix protein | Antitoxin |
QDV36_RS04140 (QDV36_04135) | 5061..5279 | - | 219 | WP_002193751.1 | TonB family protein | - |
QDV36_RS04145 (QDV36_04140) | 5276..5647 | - | 372 | WP_001237044.1 | cell envelope integrity protein TolA | - |
QDV36_RS04150 (QDV36_04145) | 5921..6166 | - | 246 | WP_004146442.1 | hypothetical protein | - |
QDV36_RS04155 (QDV36_04150) | 6493..8178 | + | 1686 | WP_032440457.1 | colicin-like bacteriocin tRNase domain-containing protein | - |
QDV36_RS04160 (QDV36_04155) | 8188..8445 | + | 258 | WP_032440455.1 | colicin E3-like toxin immunity protein | - |
QDV36_RS04165 (QDV36_04160) | 8530..8679 | + | 150 | WP_032440454.1 | colicin release lysis protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaTEM-1B | - | 1..15014 | 15014 | |
- | flank | IS/Tn | - | - | 71..2545 | 2474 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11847.77 Da Isoelectric Point: 9.8619
>T277218 WP_001136729.1 NZ_CP122585:c4453-4139 [Klebsiella pneumoniae]
MPQVTISALAQRDLQRLQDFLKTKNRLAARKAGEVIVRAIQQLKTLPDIGRPVPFLPLEYQELVIGFGDSGYVMLYRHDR
EMDRIVIVTVRHQKESGYPGADSL
MPQVTISALAQRDLQRLQDFLKTKNRLAARKAGEVIVRAIQQLKTLPDIGRPVPFLPLEYQELVIGFGDSGYVMLYRHDR
EMDRIVIVTVRHQKESGYPGADSL
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A060VNB1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2X1PRM1 |