277217

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 5816..6341 Replicon plasmid pNCRE-61-100.0
Accession NZ_CP122583
Organism Klebsiella pneumoniae strain NCRE-61

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag QDV36_RS03175 Protein ID WP_013023785.1
Coordinates 5816..6121 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag QDV36_RS03180 Protein ID WP_001568025.1
Coordinates 6123..6341 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDV36_RS03145 (QDV36_03140) 1519..2145 + 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -
QDV36_RS03150 (QDV36_03145) 2142..2444 + 303 WP_004197636.1 hypothetical protein -
QDV36_RS03155 (QDV36_03150) 2892..3686 - 795 WP_004197635.1 site-specific integrase -
QDV36_RS03160 (QDV36_03155) 3884..4900 - 1017 WP_017899884.1 hypothetical protein -
QDV36_RS03165 (QDV36_03160) 4911..5225 - 315 WP_053389906.1 hypothetical protein -
QDV36_RS03170 (QDV36_03165) 5252..5647 - 396 WP_017899885.1 hypothetical protein -
QDV36_RS03175 (QDV36_03170) 5816..6121 - 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
QDV36_RS03180 (QDV36_03175) 6123..6341 - 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
QDV36_RS03185 (QDV36_03180) 6895..7584 + 690 WP_004193995.1 hypothetical protein -
QDV36_RS03190 (QDV36_03185) 7616..8305 - 690 WP_020315560.1 RES family NAD+ phosphorylase -
QDV36_RS03195 (QDV36_03190) 8742..8990 + 249 WP_000272716.1 hypothetical protein -
QDV36_RS03200 (QDV36_03195) 8987..9559 + 573 WP_020805590.1 hypothetical protein -
QDV36_RS03205 (QDV36_03200) 9590..10084 + 495 WP_020805591.1 hypothetical protein -
QDV36_RS03210 (QDV36_03205) 10128..10496 + 369 WP_004197807.1 hypothetical protein -
QDV36_RS03215 (QDV36_03210) 10530..10733 + 204 WP_004197808.1 HHA domain-containing protein -
QDV36_RS03220 (QDV36_03215) 10747..10950 + 204 WP_004197809.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaDHA-1 / qnrB4 - 1..100034 100034


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T277217 WP_013023785.1 NZ_CP122583:c6121-5816 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT277217 WP_001568025.1 NZ_CP122583:c6341-6123 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References