277215

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 138805..139475 Replicon plasmid pNCRE-61-vir
Accession NZ_CP122579
Organism Klebsiella pneumoniae strain NCRE-61

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag QDV36_RS00725 Protein ID WP_004213072.1
Coordinates 138805..139248 (-) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag QDV36_RS00730 Protein ID WP_004213073.1
Coordinates 139245..139475 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDV36_RS00690 (QDV36_00690) 134215..134490 + 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -
QDV36_RS00695 (QDV36_00695) 134553..135044 + 492 WP_011251327.1 DM13 domain-containing protein -
QDV36_RS00700 (QDV36_00700) 135093..136013 + 921 WP_004213934.1 DUF1471 domain-containing protein -
QDV36_RS00705 (QDV36_00705) 136104..136507 + 404 Protein_140 GAF domain-containing protein -
QDV36_RS00710 (QDV36_00710) 137026..137661 - 636 WP_165475474.1 mucoid phenotype regulator RmpA2 -
QDV36_RS00715 (QDV36_00715) 138078..138382 + 305 Protein_142 transposase -
QDV36_RS00720 (QDV36_00720) 138405..138656 - 252 WP_186987481.1 hypothetical protein -
QDV36_RS00725 (QDV36_00725) 138805..139248 - 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
QDV36_RS00730 (QDV36_00730) 139245..139475 - 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QDV36_RS00735 (QDV36_00735) 140083..141216 + 1134 WP_004213075.1 DUF3800 domain-containing protein -
QDV36_RS00740 (QDV36_00740) 141232..141525 + 294 WP_004213076.1 hypothetical protein -
QDV36_RS00745 (QDV36_00745) 141515..141721 - 207 WP_004213077.1 hypothetical protein -
QDV36_RS00750 (QDV36_00750) 142073..142363 + 291 WP_004213078.1 hypothetical protein -
QDV36_RS00755 (QDV36_00755) 142353..143252 + 900 WP_004225022.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroB / iroC / iroD / iroN / rmpA / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA / pla 1..205089 205089


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T277215 WP_004213072.1 NZ_CP122579:c139248-138805 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT277215 WP_004213073.1 NZ_CP122579:c139475-139245 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References