Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5206600..5207225 | Replicon | chromosome |
| Accession | NZ_CP122578 | ||
| Organism | Klebsiella pneumoniae strain KP-2683-1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A330XB05 |
| Locus tag | QDV38_RS27925 | Protein ID | WP_012737091.1 |
| Coordinates | 5206600..5206983 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | QDV38_RS27930 | Protein ID | WP_004150355.1 |
| Coordinates | 5206983..5207225 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDV38_RS27910 (5203966) | 5203966..5204868 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| QDV38_RS27915 (5204865) | 5204865..5205500 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| QDV38_RS27920 (5205497) | 5205497..5206426 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| QDV38_RS27925 (5206600) | 5206600..5206983 | - | 384 | WP_012737091.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QDV38_RS27930 (5206983) | 5206983..5207225 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| QDV38_RS27935 (5207430) | 5207430..5208347 | + | 918 | WP_012737090.1 | alpha/beta hydrolase | - |
| QDV38_RS27940 (5208361) | 5208361..5209302 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
| QDV38_RS27945 (5209347) | 5209347..5209784 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
| QDV38_RS27950 (5209781) | 5209781..5210641 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
| QDV38_RS27955 (5210635) | 5210635..5211234 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14266.53 Da Isoelectric Point: 7.2771
>T277212 WP_012737091.1 NZ_CP122578:c5206983-5206600 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRCEAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKGFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRCEAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKGFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A330XB05 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |