Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4735575..4736091 | Replicon | chromosome |
| Accession | NZ_CP122578 | ||
| Organism | Klebsiella pneumoniae strain KP-2683-1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | R4YAY3 |
| Locus tag | QDV38_RS25675 | Protein ID | WP_004178374.1 |
| Coordinates | 4735575..4735859 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | QDV38_RS25680 | Protein ID | WP_002886901.1 |
| Coordinates | 4735849..4736091 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDV38_RS25650 (4730971) | 4730971..4731234 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
| QDV38_RS25655 (4731364) | 4731364..4731537 | + | 174 | WP_041169004.1 | hypothetical protein | - |
| QDV38_RS25660 (4731540) | 4731540..4732283 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| QDV38_RS25665 (4732640) | 4732640..4734778 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| QDV38_RS25670 (4735107) | 4735107..4735571 | + | 465 | WP_004222151.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| QDV38_RS25675 (4735575) | 4735575..4735859 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QDV38_RS25680 (4735849) | 4735849..4736091 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| QDV38_RS25685 (4736169) | 4736169..4738079 | - | 1911 | WP_012737231.1 | PRD domain-containing protein | - |
| QDV38_RS25690 (4738102) | 4738102..4739256 | - | 1155 | WP_012737230.1 | lactonase family protein | - |
| QDV38_RS25695 (4739323) | 4739323..4740063 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T277211 WP_004178374.1 NZ_CP122578:c4735859-4735575 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A6THG1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |