Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 4569664..4570474 | Replicon | chromosome |
Accession | NZ_CP122578 | ||
Organism | Klebsiella pneumoniae strain KP-2683-1 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A332NV98 |
Locus tag | QDV38_RS24950 | Protein ID | WP_014908042.1 |
Coordinates | 4569664..4570197 (-) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | J2E9Q7 |
Locus tag | QDV38_RS24955 | Protein ID | WP_002887278.1 |
Coordinates | 4570208..4570474 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDV38_RS24945 (4568495) | 4568495..4569616 | + | 1122 | WP_012737335.1 | cupin domain-containing protein | - |
QDV38_RS24950 (4569664) | 4569664..4570197 | - | 534 | WP_014908042.1 | type II toxin-antitoxin system toxin KacT | Toxin |
QDV38_RS24955 (4570208) | 4570208..4570474 | - | 267 | WP_002887278.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
QDV38_RS24960 (4570577) | 4570577..4572010 | - | 1434 | WP_014908043.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
QDV38_RS24965 (4572000) | 4572000..4572683 | - | 684 | WP_002887273.1 | copper response regulator transcription factor CusR | - |
QDV38_RS24970 (4572855) | 4572855..4574240 | + | 1386 | WP_012737332.1 | efflux transporter outer membrane subunit | - |
QDV38_RS24975 (4574258) | 4574258..4574602 | + | 345 | WP_012737331.1 | cation efflux system protein CusF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19795.68 Da Isoelectric Point: 5.2614
>T277210 WP_014908042.1 NZ_CP122578:c4570197-4569664 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGLGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGLGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A332NV98 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 5ZGN | |
AlphaFold DB | A0A0H3GLZ1 |