Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3981198..3981817 Replicon chromosome
Accession NZ_CP122578
Organism Klebsiella pneumoniae strain KP-2683-1

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag QDV38_RS22125 Protein ID WP_002892050.1
Coordinates 3981599..3981817 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag QDV38_RS22120 Protein ID WP_002892066.1
Coordinates 3981198..3981572 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDV38_RS22110 (3976350) 3976350..3977543 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
QDV38_RS22115 (3977566) 3977566..3980712 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
QDV38_RS22120 (3981198) 3981198..3981572 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
QDV38_RS22125 (3981599) 3981599..3981817 + 219 WP_002892050.1 HHA domain-containing protein Toxin
QDV38_RS22130 (3981976) 3981976..3982542 + 567 WP_002892030.1 maltose O-acetyltransferase -
QDV38_RS22135 (3982514) 3982514..3982654 - 141 WP_004147370.1 hypothetical protein -
QDV38_RS22140 (3982675) 3982675..3983145 + 471 WP_002892026.1 YlaC family protein -
QDV38_RS22145 (3983120) 3983120..3984577 - 1458 WP_279956676.1 PLP-dependent aminotransferase family protein -
QDV38_RS22150 (3984678) 3984678..3985376 + 699 WP_002892021.1 GNAT family protein -
QDV38_RS22155 (3985373) 3985373..3985513 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
QDV38_RS22160 (3985513) 3985513..3985776 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T277209 WP_002892050.1 NZ_CP122578:3981599-3981817 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT277209 WP_002892066.1 NZ_CP122578:3981198-3981572 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References