Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 1799652..1800295 Replicon chromosome
Accession NZ_CP122578
Organism Klebsiella pneumoniae strain KP-2683-1

Toxin (Protein)


Gene name vagD Uniprot ID A4GZE5
Locus tag QDV38_RS11525 Protein ID WP_015874977.1
Coordinates 1799652..1800068 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A4GZE4
Locus tag QDV38_RS11530 Protein ID WP_015874976.1
Coordinates 1800065..1800295 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDV38_RS11505 (1795055) 1795055..1796170 - 1116 WP_032447702.1 salmochelin biosynthesis C-glycosyltransferase IroB -
QDV38_RS11510 (1796343) 1796343..1796621 - 279 Protein_1689 ISNCY family transposase -
QDV38_RS11515 (1797042) 1797042..1799216 + 2175 WP_015874979.1 siderophore salmochelin receptor IroN -
QDV38_RS11520 (1799371) 1799371..1799616 - 246 WP_032447699.1 hypothetical protein -
QDV38_RS11525 (1799652) 1799652..1800068 - 417 WP_015874977.1 type II toxin-antitoxin system VapC family toxin Toxin
QDV38_RS11530 (1800065) 1800065..1800295 - 231 WP_015874976.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QDV38_RS11535 (1800789) 1800789..1801118 + 330 WP_225315331.1 hypothetical protein -
QDV38_RS11540 (1801306) 1801306..1802276 + 971 Protein_1695 IS21-like element IS100 family transposase -
QDV38_RS11545 (1802303) 1802303..1803029 + 727 Protein_1696 IS21-like element helper ATPase IstB -
QDV38_RS11550 (1803073) 1803073..1803186 - 114 WP_015874970.1 Hha/YmoA family nucleoid-associated regulatory protein -
QDV38_RS11555 (1803429) 1803429..1803638 - 210 WP_032447696.1 TraR/DksA family transcriptional regulator -
QDV38_RS11560 (1803628) 1803628..1804209 - 582 WP_000937857.1 DUF2857 domain-containing protein -
QDV38_RS11565 (1804194) 1804194..1804376 - 183 WP_072001695.1 hypothetical protein -
QDV38_RS11570 (1804398) 1804398..1804583 - 186 WP_000205185.1 AlpA family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - rmpA / iroD / iroC / iroB / iroN / fyuA / ybtE / ybtT / ybtU 1754251..1819971 65720


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14945.39 Da        Isoelectric Point: 8.5464

>T277203 WP_015874977.1 NZ_CP122578:c1800068-1799652 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAGLRGDRIVVSAVTYAEMRFGATGPKASPHHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8749.80 Da        Isoelectric Point: 4.3533

>AT277203 WP_015874976.1 NZ_CP122578:c1800295-1800065 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMVEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A4GZE5

Antitoxin

Source ID Structure
AlphaFold DB A4GZE4

References