Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 158246..158823 | Replicon | plasmid pKP-2683-1-174.8 |
Accession | NZ_CP122576 | ||
Organism | Klebsiella pneumoniae strain KP-2683-1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | QDV38_RS02680 | Protein ID | WP_023286013.1 |
Coordinates | 158491..158823 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | QDV38_RS02675 | Protein ID | WP_023286014.1 |
Coordinates | 158246..158491 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDV38_RS02645 (QDV38_02650) | 153905..154342 | + | 438 | WP_080861790.1 | plasmid protein | - |
QDV38_RS02650 (QDV38_02655) | 154339..155025 | + | 687 | WP_253900371.1 | hypothetical protein | - |
QDV38_RS02655 (QDV38_02660) | 155066..155674 | + | 609 | WP_253900372.1 | hypothetical protein | - |
QDV38_RS02660 (QDV38_02665) | 156508..157194 | + | 687 | WP_150150043.1 | hypothetical protein | - |
QDV38_RS02665 (QDV38_02670) | 157262..157537 | + | 276 | WP_080861794.1 | hypothetical protein | - |
QDV38_RS02670 (QDV38_02675) | 157607..158164 | + | 558 | WP_141489877.1 | hypothetical protein | - |
QDV38_RS02675 (QDV38_02680) | 158246..158491 | + | 246 | WP_023286014.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
QDV38_RS02680 (QDV38_02685) | 158491..158823 | + | 333 | WP_023286013.1 | endoribonuclease MazF | Toxin |
QDV38_RS02685 (QDV38_02690) | 159103..159417 | + | 315 | WP_114261650.1 | hypothetical protein | - |
QDV38_RS02690 (QDV38_02695) | 159542..160180 | + | 639 | WP_279956646.1 | hypothetical protein | - |
QDV38_RS02695 (QDV38_02700) | 160192..160494 | + | 303 | WP_023286010.1 | hypothetical protein | - |
QDV38_RS02700 (QDV38_02705) | 160586..161005 | + | 420 | WP_023286009.1 | hypothetical protein | - |
QDV38_RS02705 (QDV38_02710) | 161054..161368 | + | 315 | WP_023286008.1 | hypothetical protein | - |
QDV38_RS02710 (QDV38_02715) | 161358..161564 | + | 207 | WP_023286007.1 | hypothetical protein | - |
QDV38_RS02715 (QDV38_02720) | 161734..162594 | + | 861 | WP_023286006.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..174840 | 174840 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11943.82 Da Isoelectric Point: 8.7208
>T277199 WP_023286013.1 NZ_CP122576:158491-158823 [Klebsiella pneumoniae]
MVKRYVPDAGDLIWIDFDPVAGHEQGGHRPAVVLSPFAYNNKVGLLLCVPCTTQVKGYPFEVTLSGSKEGVALSDQITCV
DWRARKVTQKSTVSKSELAEIRAKAKALIG
MVKRYVPDAGDLIWIDFDPVAGHEQGGHRPAVVLSPFAYNNKVGLLLCVPCTTQVKGYPFEVTLSGSKEGVALSDQITCV
DWRARKVTQKSTVSKSELAEIRAKAKALIG
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|