Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 155987..156657 | Replicon | plasmid pKP-2683-1-vir |
| Accession | NZ_CP122574 | ||
| Organism | Klebsiella pneumoniae strain KP-2683-1 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | Q6U619 |
| Locus tag | QDV38_RS00865 | Protein ID | WP_004213072.1 |
| Coordinates | 155987..156430 (-) | Length | 148 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q6U620 |
| Locus tag | QDV38_RS00870 | Protein ID | WP_004213073.1 |
| Coordinates | 156427..156657 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDV38_RS00830 (QDV38_00830) | 151396..151671 | + | 276 | WP_004213932.1 | carboxymuconolactone decarboxylase family protein | - |
| QDV38_RS00835 (QDV38_00835) | 151734..152225 | + | 492 | WP_011251327.1 | DM13 domain-containing protein | - |
| QDV38_RS00840 (QDV38_00840) | 152274..153194 | + | 921 | WP_004213934.1 | DUF1471 domain-containing protein | - |
| QDV38_RS00845 (QDV38_00845) | 153285..153688 | + | 404 | Protein_168 | GAF domain-containing protein | - |
| QDV38_RS00850 (QDV38_00850) | 154206..154843 | - | 638 | Protein_169 | mucoid phenotype regulator RmpA2 | - |
| QDV38_RS00855 (QDV38_00855) | 155260..155564 | + | 305 | Protein_170 | transposase | - |
| QDV38_RS00860 (QDV38_00860) | 155587..155838 | - | 252 | WP_186987481.1 | hypothetical protein | - |
| QDV38_RS00865 (QDV38_00865) | 155987..156430 | - | 444 | WP_004213072.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QDV38_RS00870 (QDV38_00870) | 156427..156657 | - | 231 | WP_004213073.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QDV38_RS00875 (QDV38_00875) | 157265..158398 | + | 1134 | WP_004213075.1 | DUF3800 domain-containing protein | - |
| QDV38_RS00880 (QDV38_00880) | 158414..158707 | + | 294 | WP_004213076.1 | hypothetical protein | - |
| QDV38_RS00885 (QDV38_00885) | 158697..158903 | - | 207 | WP_004213077.1 | hypothetical protein | - |
| QDV38_RS00890 (QDV38_00890) | 159255..159545 | + | 291 | WP_004213078.1 | hypothetical protein | - |
| QDV38_RS00895 (QDV38_00895) | 159535..160434 | + | 900 | WP_004225022.1 | nucleotide-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | iroB / iroC / iroD / iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA | 1..229269 | 229269 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16006.74 Da Isoelectric Point: 9.3642
>T277198 WP_004213072.1 NZ_CP122574:c156430-155987 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|