Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 155987..156657 Replicon plasmid pKP-2683-1-vir
Accession NZ_CP122574
Organism Klebsiella pneumoniae strain KP-2683-1

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag QDV38_RS00865 Protein ID WP_004213072.1
Coordinates 155987..156430 (-) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag QDV38_RS00870 Protein ID WP_004213073.1
Coordinates 156427..156657 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDV38_RS00830 (QDV38_00830) 151396..151671 + 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -
QDV38_RS00835 (QDV38_00835) 151734..152225 + 492 WP_011251327.1 DM13 domain-containing protein -
QDV38_RS00840 (QDV38_00840) 152274..153194 + 921 WP_004213934.1 DUF1471 domain-containing protein -
QDV38_RS00845 (QDV38_00845) 153285..153688 + 404 Protein_168 GAF domain-containing protein -
QDV38_RS00850 (QDV38_00850) 154206..154843 - 638 Protein_169 mucoid phenotype regulator RmpA2 -
QDV38_RS00855 (QDV38_00855) 155260..155564 + 305 Protein_170 transposase -
QDV38_RS00860 (QDV38_00860) 155587..155838 - 252 WP_186987481.1 hypothetical protein -
QDV38_RS00865 (QDV38_00865) 155987..156430 - 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
QDV38_RS00870 (QDV38_00870) 156427..156657 - 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QDV38_RS00875 (QDV38_00875) 157265..158398 + 1134 WP_004213075.1 DUF3800 domain-containing protein -
QDV38_RS00880 (QDV38_00880) 158414..158707 + 294 WP_004213076.1 hypothetical protein -
QDV38_RS00885 (QDV38_00885) 158697..158903 - 207 WP_004213077.1 hypothetical protein -
QDV38_RS00890 (QDV38_00890) 159255..159545 + 291 WP_004213078.1 hypothetical protein -
QDV38_RS00895 (QDV38_00895) 159535..160434 + 900 WP_004225022.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroB / iroC / iroD / iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA 1..229269 229269


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T277198 WP_004213072.1 NZ_CP122574:c156430-155987 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT277198 WP_004213073.1 NZ_CP122574:c156657-156427 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References