Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4729800..4730316 | Replicon | chromosome |
Accession | NZ_CP122573 | ||
Organism | Klebsiella pneumoniae strain KP2185 |
Toxin (Protein)
Gene name | relE | Uniprot ID | J2XDK6 |
Locus tag | QDV37_RS27390 | Protein ID | WP_002886902.1 |
Coordinates | 4729800..4730084 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | QDV37_RS27395 | Protein ID | WP_002886901.1 |
Coordinates | 4730074..4730316 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDV37_RS27365 (QDV37_27385) | 4725284..4725547 | - | 264 | WP_004152271.1 | PTS sugar transporter subunit IIB | - |
QDV37_RS27370 (QDV37_27390) | 4725677..4725850 | + | 174 | WP_002886906.1 | hypothetical protein | - |
QDV37_RS27375 (QDV37_27395) | 4725853..4726596 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
QDV37_RS27380 (QDV37_27400) | 4726953..4729091 | + | 2139 | WP_002886904.1 | anaerobic ribonucleoside-triphosphate reductase | - |
QDV37_RS27385 (QDV37_27405) | 4729332..4729796 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
QDV37_RS27390 (QDV37_27410) | 4729800..4730084 | - | 285 | WP_002886902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QDV37_RS27395 (QDV37_27415) | 4730074..4730316 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
QDV37_RS27400 (QDV37_27420) | 4730394..4732304 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
QDV37_RS27405 (QDV37_27425) | 4732327..4733481 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
QDV37_RS27410 (QDV37_27430) | 4733547..4734287 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.3787
>T277193 WP_002886902.1 NZ_CP122573:c4730084-4729800 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GMH2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |