Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4015018..4015637 Replicon chromosome
Accession NZ_CP122573
Organism Klebsiella pneumoniae strain KP2185

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag QDV37_RS23960 Protein ID WP_002892050.1
Coordinates 4015419..4015637 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag QDV37_RS23955 Protein ID WP_002892066.1
Coordinates 4015018..4015392 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDV37_RS23945 (QDV37_23960) 4010170..4011363 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
QDV37_RS23950 (QDV37_23965) 4011386..4014532 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
QDV37_RS23955 (QDV37_23970) 4015018..4015392 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
QDV37_RS23960 (QDV37_23975) 4015419..4015637 + 219 WP_002892050.1 HHA domain-containing protein Toxin
QDV37_RS23965 (QDV37_23980) 4015796..4016362 + 567 WP_002892030.1 maltose O-acetyltransferase -
QDV37_RS23970 (QDV37_23985) 4016334..4016474 - 141 WP_004147370.1 hypothetical protein -
QDV37_RS23975 (QDV37_23990) 4016495..4016965 + 471 WP_002892026.1 YlaC family protein -
QDV37_RS23980 (QDV37_23995) 4016940..4018391 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
QDV37_RS23985 (QDV37_24000) 4018492..4019190 + 699 WP_002892021.1 GNAT family protein -
QDV37_RS23990 (QDV37_24005) 4019187..4019327 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
QDV37_RS23995 (QDV37_24010) 4019327..4019590 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T277191 WP_002892050.1 NZ_CP122573:4015419-4015637 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT277191 WP_002892066.1 NZ_CP122573:4015018-4015392 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References