Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
Location | 2316..2896 | Replicon | plasmid pKP2185-15.0 |
Accession | NZ_CP122572 | ||
Organism | Klebsiella pneumoniae strain KP2185 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A060VNB1 |
Locus tag | QDV37_RS03760 | Protein ID | WP_001136729.1 |
Coordinates | 2316..2630 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2X1PRM1 |
Locus tag | QDV37_RS03765 | Protein ID | WP_000093040.1 |
Coordinates | 2618..2896 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDV37_RS03740 (QDV37_03740) | 724..954 | + | 231 | WP_231828916.1 | hypothetical protein | - |
QDV37_RS03745 (QDV37_03745) | 961..1491 | + | 531 | WP_065521056.1 | hypothetical protein | - |
QDV37_RS03750 (QDV37_03750) | 1519..1698 | - | 180 | WP_065521055.1 | Rop family plasmid primer RNA-binding protein | - |
QDV37_RS03755 (QDV37_03755) | 1724..2152 | - | 429 | WP_001140599.1 | hypothetical protein | - |
QDV37_RS03760 (QDV37_03760) | 2316..2630 | - | 315 | WP_001136729.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QDV37_RS03765 (QDV37_03765) | 2618..2896 | - | 279 | WP_000093040.1 | CopG family ribbon-helix-helix protein | Antitoxin |
QDV37_RS03770 (QDV37_03770) | 3238..3456 | - | 219 | WP_002193751.1 | TonB family protein | - |
QDV37_RS03775 (QDV37_03775) | 3453..3824 | - | 372 | WP_001237044.1 | cell envelope integrity protein TolA | - |
QDV37_RS03780 (QDV37_03780) | 4098..4343 | - | 246 | WP_004146442.1 | hypothetical protein | - |
QDV37_RS03785 (QDV37_03785) | 4670..6355 | + | 1686 | WP_032440457.1 | colicin-like bacteriocin tRNase domain-containing protein | - |
QDV37_RS03790 (QDV37_03790) | 6365..6622 | + | 258 | WP_032440455.1 | colicin E3-like toxin immunity protein | - |
QDV37_RS03795 (QDV37_03795) | 6707..6856 | + | 150 | WP_032440454.1 | colicin release lysis protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaTEM-1B | - | 1..15032 | 15032 | |
- | flank | IS/Tn | - | - | 102..722 | 620 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11847.77 Da Isoelectric Point: 9.8619
>T277181 WP_001136729.1 NZ_CP122572:c2630-2316 [Klebsiella pneumoniae]
MPQVTISALAQRDLQRLQDFLKTKNRLAARKAGEVIVRAIQQLKTLPDIGRPVPFLPLEYQELVIGFGDSGYVMLYRHDR
EMDRIVIVTVRHQKESGYPGADSL
MPQVTISALAQRDLQRLQDFLKTKNRLAARKAGEVIVRAIQQLKTLPDIGRPVPFLPLEYQELVIGFGDSGYVMLYRHDR
EMDRIVIVTVRHQKESGYPGADSL
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A060VNB1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2X1PRM1 |