Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 137507..138147 | Replicon | plasmid pKP2185-vir |
| Accession | NZ_CP122567 | ||
| Organism | Klebsiella pneumoniae strain KP2185 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | QDV37_RS00720 | Protein ID | WP_231828924.1 |
| Coordinates | 137507..137920 (-) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q6U620 |
| Locus tag | QDV37_RS00725 | Protein ID | WP_004213073.1 |
| Coordinates | 137917..138147 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDV37_RS00685 (QDV37_00685) | 132887..133162 | + | 276 | WP_004213932.1 | carboxymuconolactone decarboxylase family protein | - |
| QDV37_RS00690 (QDV37_00690) | 133225..133716 | + | 492 | WP_011251327.1 | DM13 domain-containing protein | - |
| QDV37_RS00695 (QDV37_00695) | 133765..134685 | + | 921 | WP_004213934.1 | DUF1471 domain-containing protein | - |
| QDV37_RS00700 (QDV37_00700) | 134776..135179 | + | 404 | Protein_139 | GAF domain-containing protein | - |
| QDV37_RS00705 (QDV37_00705) | 135698..136333 | - | 636 | WP_165475474.1 | mucoid phenotype regulator RmpA2 | - |
| QDV37_RS00710 (QDV37_00710) | 136750..137054 | + | 305 | Protein_141 | transposase | - |
| QDV37_RS00715 (QDV37_00715) | 137077..137328 | - | 252 | WP_186987481.1 | hypothetical protein | - |
| QDV37_RS00720 (QDV37_00720) | 137507..137920 | - | 414 | WP_231828924.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QDV37_RS00725 (QDV37_00725) | 137917..138147 | - | 231 | WP_004213073.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QDV37_RS00730 (QDV37_00730) | 138755..139888 | + | 1134 | WP_004213075.1 | DUF3800 domain-containing protein | - |
| QDV37_RS00735 (QDV37_00735) | 139904..140197 | + | 294 | WP_004213076.1 | hypothetical protein | - |
| QDV37_RS00740 (QDV37_00740) | 140187..140393 | - | 207 | WP_004213077.1 | hypothetical protein | - |
| QDV37_RS00745 (QDV37_00745) | 140745..141035 | + | 291 | WP_004213078.1 | hypothetical protein | - |
| QDV37_RS00750 (QDV37_00750) | 141025..141924 | + | 900 | WP_004225022.1 | nucleotide-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | iroB / iroC / iroD / iroN / rmpA / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA / pla | 1..203769 | 203769 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 14936.38 Da Isoelectric Point: 7.8644
>T277178 WP_231828924.1 NZ_CP122567:c137920-137507 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWV
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWV
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|