277178

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 137507..138147 Replicon plasmid pKP2185-vir
Accession NZ_CP122567
Organism Klebsiella pneumoniae strain KP2185

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag QDV37_RS00720 Protein ID WP_231828924.1
Coordinates 137507..137920 (-) Length 138 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag QDV37_RS00725 Protein ID WP_004213073.1
Coordinates 137917..138147 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDV37_RS00685 (QDV37_00685) 132887..133162 + 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -
QDV37_RS00690 (QDV37_00690) 133225..133716 + 492 WP_011251327.1 DM13 domain-containing protein -
QDV37_RS00695 (QDV37_00695) 133765..134685 + 921 WP_004213934.1 DUF1471 domain-containing protein -
QDV37_RS00700 (QDV37_00700) 134776..135179 + 404 Protein_139 GAF domain-containing protein -
QDV37_RS00705 (QDV37_00705) 135698..136333 - 636 WP_165475474.1 mucoid phenotype regulator RmpA2 -
QDV37_RS00710 (QDV37_00710) 136750..137054 + 305 Protein_141 transposase -
QDV37_RS00715 (QDV37_00715) 137077..137328 - 252 WP_186987481.1 hypothetical protein -
QDV37_RS00720 (QDV37_00720) 137507..137920 - 414 WP_231828924.1 type II toxin-antitoxin system VapC family toxin Toxin
QDV37_RS00725 (QDV37_00725) 137917..138147 - 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QDV37_RS00730 (QDV37_00730) 138755..139888 + 1134 WP_004213075.1 DUF3800 domain-containing protein -
QDV37_RS00735 (QDV37_00735) 139904..140197 + 294 WP_004213076.1 hypothetical protein -
QDV37_RS00740 (QDV37_00740) 140187..140393 - 207 WP_004213077.1 hypothetical protein -
QDV37_RS00745 (QDV37_00745) 140745..141035 + 291 WP_004213078.1 hypothetical protein -
QDV37_RS00750 (QDV37_00750) 141025..141924 + 900 WP_004225022.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroB / iroC / iroD / iroN / rmpA / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA / pla 1..203769 203769


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 14936.38 Da        Isoelectric Point: 7.8644

>T277178 WP_231828924.1 NZ_CP122567:c137920-137507 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWV

Download         Length: 414 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT277178 WP_004213073.1 NZ_CP122567:c138147-137917 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References