Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 47032..47768 | Replicon | plasmid pKP2185-vir |
Accession | NZ_CP122567 | ||
Organism | Klebsiella pneumoniae strain KP2185 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A2J5Q928 |
Locus tag | QDV37_RS00225 | Protein ID | WP_004098919.1 |
Coordinates | 47286..47768 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | A0A7D3T1D0 |
Locus tag | QDV37_RS00220 | Protein ID | WP_004213599.1 |
Coordinates | 47032..47298 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDV37_RS00195 (QDV37_00195) | 42264..42821 | + | 558 | WP_004213590.1 | recombinase family protein | - |
QDV37_RS00200 (QDV37_00200) | 42824..45793 | + | 2970 | WP_094936121.1 | Tn3 family transposase | - |
QDV37_RS00205 (QDV37_00205) | 45835..46329 | + | 495 | WP_004213594.1 | hypothetical protein | - |
QDV37_RS00210 (QDV37_00210) | 46390..46593 | + | 204 | WP_004213596.1 | HHA domain-containing protein | - |
QDV37_RS00215 (QDV37_00215) | 46607..46837 | + | 231 | WP_004213598.1 | hypothetical protein | - |
QDV37_RS00220 (QDV37_00220) | 47032..47298 | + | 267 | WP_004213599.1 | DUF1778 domain-containing protein | Antitoxin |
QDV37_RS00225 (QDV37_00225) | 47286..47768 | + | 483 | WP_004098919.1 | GNAT family N-acetyltransferase | Toxin |
QDV37_RS00230 (QDV37_00230) | 47969..49372 | + | 1404 | WP_001567368.1 | ISNCY-like element ISKpn21 family transposase | - |
QDV37_RS00235 (QDV37_00235) | 49401..50033 | - | 633 | WP_001567369.1 | hypothetical protein | - |
QDV37_RS00240 (QDV37_00240) | 50472..51699 | + | 1228 | Protein_47 | IS3 family transposase | - |
QDV37_RS00245 (QDV37_00245) | 51695..52090 | - | 396 | Protein_48 | IS3 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | iroB / iroC / iroD / iroN / rmpA / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA / pla | 1..203769 | 203769 | |
- | inside | IScluster/Tn | - | - | 42264..51699 | 9435 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17335.06 Da Isoelectric Point: 10.0704
>T277176 WP_004098919.1 NZ_CP122567:47286-47768 [Klebsiella pneumoniae]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J5Q928 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7D3T1D0 |