Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 2855336..2855991 | Replicon | chromosome |
| Accession | NZ_CP122566 | ||
| Organism | Auritidibacter ignavus strain BABAE-6 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QDX21_RS13175 | Protein ID | WP_110100005.1 |
| Coordinates | 2855566..2855991 (+) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QDX21_RS13170 | Protein ID | WP_110100006.1 |
| Coordinates | 2855336..2855569 (+) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX21_RS13160 (QDX21_13160) | 2851601..2853808 | - | 2208 | WP_279674872.1 | choline BCCT transporter BetT | - |
| QDX21_RS13165 (QDX21_13165) | 2854103..2855188 | + | 1086 | WP_279674873.1 | redox-regulated ATPase YchF | - |
| QDX21_RS13170 (QDX21_13170) | 2855336..2855569 | + | 234 | WP_110100006.1 | Arc family DNA-binding protein | Antitoxin |
| QDX21_RS13175 (QDX21_13175) | 2855566..2855991 | + | 426 | WP_110100005.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QDX21_RS13180 (QDX21_13180) | 2856004..2856540 | + | 537 | WP_158278495.1 | GNAT family N-acetyltransferase | - |
| QDX21_RS13185 (QDX21_13185) | 2857084..2857809 | + | 726 | WP_110100002.1 | hypothetical protein | - |
| QDX21_RS13190 (QDX21_13190) | 2858034..2858267 | + | 234 | Protein_2580 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QDX21_RS13195 (QDX21_13195) | 2858273..2858578 | + | 306 | WP_279675474.1 | helix-turn-helix transcriptional regulator | - |
| QDX21_RS13200 (QDX21_13200) | 2858729..2858962 | + | 234 | WP_279674874.1 | hypothetical protein | - |
| QDX21_RS13205 (QDX21_13205) | 2858947..2859321 | + | 375 | WP_279674875.1 | hypothetical protein | - |
| QDX21_RS13210 (QDX21_13210) | 2859587..2860351 | + | 765 | WP_110100200.1 | sulfite exporter TauE/SafE family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15267.47 Da Isoelectric Point: 5.2123
>T277175 WP_110100005.1 NZ_CP122566:2855566-2855991 [Auritidibacter ignavus]
VIILDTNVISEIFRPLPEPRVADWLTSLEGDVAITSVTLAELLAGLRRLPDGRRRDALTRRIDVALAPYRGGRAVLPFDD
VAADRYADVLVARERAGAPISTADAQIAAICLAHGATCATRNVKDFQHTGVELVDPWKVDA
VIILDTNVISEIFRPLPEPRVADWLTSLEGDVAITSVTLAELLAGLRRLPDGRRRDALTRRIDVALAPYRGGRAVLPFDD
VAADRYADVLVARERAGAPISTADAQIAAICLAHGATCATRNVKDFQHTGVELVDPWKVDA
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|