Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 26733..27388 | Replicon | chromosome |
Accession | NZ_CP122565 | ||
Organism | Auritidibacter ignavus strain BABAE-5 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QDX23_RS00135 | Protein ID | WP_110100194.1 |
Coordinates | 26963..27388 (+) | Length | 142 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QDX23_RS00130 | Protein ID | WP_110100006.1 |
Coordinates | 26733..26966 (+) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX23_RS00120 (QDX23_00120) | 22998..25205 | - | 2208 | WP_110100192.1 | choline BCCT transporter BetT | - |
QDX23_RS00125 (QDX23_00125) | 25500..26585 | + | 1086 | WP_110100193.1 | redox-regulated ATPase YchF | - |
QDX23_RS00130 (QDX23_00130) | 26733..26966 | + | 234 | WP_110100006.1 | Arc family DNA-binding protein | Antitoxin |
QDX23_RS00135 (QDX23_00135) | 26963..27388 | + | 426 | WP_110100194.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QDX23_RS00140 (QDX23_00140) | 27401..27937 | + | 537 | WP_158524689.1 | GNAT family N-acetyltransferase | - |
QDX23_RS00145 (QDX23_00145) | 28481..29206 | + | 726 | WP_110100197.1 | hypothetical protein | - |
QDX23_RS00150 (QDX23_00150) | 29473..29664 | + | 192 | WP_233487799.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
QDX23_RS00155 (QDX23_00155) | 29670..29975 | + | 306 | WP_110100392.1 | helix-turn-helix transcriptional regulator | - |
QDX23_RS00160 (QDX23_00160) | 30344..30718 | + | 375 | WP_146206389.1 | hypothetical protein | - |
QDX23_RS00165 (QDX23_00165) | 30984..31748 | + | 765 | WP_110100200.1 | sulfite exporter TauE/SafE family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15255.42 Da Isoelectric Point: 5.2123
>T277173 WP_110100194.1 NZ_CP122565:26963-27388 [Auritidibacter ignavus]
VIILDTNVISEIFRPLPEPRVADWLTSLEGDVAITSVTLAELLAGLRRLPDGRRRDALTRRIDVALAPYRGGRAVLPFDD
VAADRYADVLVARERAGAPISTADAQTAAICLAHGATCATRNVKDFQHTGVELVDPWKVDA
VIILDTNVISEIFRPLPEPRVADWLTSLEGDVAITSVTLAELLAGLRRLPDGRRRDALTRRIDVALAPYRGGRAVLPFDD
VAADRYADVLVARERAGAPISTADAQTAAICLAHGATCATRNVKDFQHTGVELVDPWKVDA
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|