Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 2634700..2635355 | Replicon | chromosome |
Accession | NZ_CP122564 | ||
Organism | Auritidibacter ignavus strain BABAE-4 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QDX22_RS11960 | Protein ID | WP_110100194.1 |
Coordinates | 2634930..2635355 (+) | Length | 142 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QDX22_RS11955 | Protein ID | WP_110100006.1 |
Coordinates | 2634700..2634933 (+) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX22_RS11945 (QDX22_11945) | 2630965..2633172 | - | 2208 | WP_110100192.1 | choline BCCT transporter BetT | - |
QDX22_RS11950 (QDX22_11950) | 2633467..2634552 | + | 1086 | WP_110100193.1 | redox-regulated ATPase YchF | - |
QDX22_RS11955 (QDX22_11955) | 2634700..2634933 | + | 234 | WP_110100006.1 | Arc family DNA-binding protein | Antitoxin |
QDX22_RS11960 (QDX22_11960) | 2634930..2635355 | + | 426 | WP_110100194.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QDX22_RS11965 (QDX22_11965) | 2635368..2635904 | + | 537 | WP_158524689.1 | GNAT family N-acetyltransferase | - |
QDX22_RS11970 (QDX22_11970) | 2636050..2636250 | - | 201 | WP_110100196.1 | hypothetical protein | - |
QDX22_RS11975 (QDX22_11975) | 2636448..2637173 | + | 726 | WP_110100197.1 | hypothetical protein | - |
QDX22_RS11980 (QDX22_11980) | 2637398..2637631 | + | 234 | Protein_2338 | type II toxin-antitoxin system RelE/ParE family toxin | - |
QDX22_RS11985 (QDX22_11985) | 2637637..2637942 | + | 306 | WP_110100392.1 | helix-turn-helix transcriptional regulator | - |
QDX22_RS11990 (QDX22_11990) | 2638093..2638326 | + | 234 | WP_110100198.1 | hypothetical protein | - |
QDX22_RS11995 (QDX22_11995) | 2638587..2638892 | + | 306 | WP_146206324.1 | hypothetical protein | - |
QDX22_RS12000 (QDX22_12000) | 2638951..2639715 | + | 765 | WP_110099999.1 | sulfite exporter TauE/SafE family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15255.42 Da Isoelectric Point: 5.2123
>T277172 WP_110100194.1 NZ_CP122564:2634930-2635355 [Auritidibacter ignavus]
VIILDTNVISEIFRPLPEPRVADWLTSLEGDVAITSVTLAELLAGLRRLPDGRRRDALTRRIDVALAPYRGGRAVLPFDD
VAADRYADVLVARERAGAPISTADAQTAAICLAHGATCATRNVKDFQHTGVELVDPWKVDA
VIILDTNVISEIFRPLPEPRVADWLTSLEGDVAITSVTLAELLAGLRRLPDGRRRDALTRRIDVALAPYRGGRAVLPFDD
VAADRYADVLVARERAGAPISTADAQTAAICLAHGATCATRNVKDFQHTGVELVDPWKVDA
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|