Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 2593923..2594578 | Replicon | chromosome |
Accession | NZ_CP122562 | ||
Organism | Auritidibacter ignavus strain BABAE-2 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QDX20_RS11670 | Protein ID | WP_110100005.1 |
Coordinates | 2594153..2594578 (+) | Length | 142 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QDX20_RS11665 | Protein ID | WP_110100006.1 |
Coordinates | 2593923..2594156 (+) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX20_RS11655 (QDX20_11655) | 2590188..2592395 | - | 2208 | WP_110100192.1 | choline BCCT transporter BetT | - |
QDX20_RS11660 (QDX20_11660) | 2592690..2593775 | + | 1086 | WP_279673607.1 | redox-regulated ATPase YchF | - |
QDX20_RS11665 (QDX20_11665) | 2593923..2594156 | + | 234 | WP_110100006.1 | Arc family DNA-binding protein | Antitoxin |
QDX20_RS11670 (QDX20_11670) | 2594153..2594578 | + | 426 | WP_110100005.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QDX20_RS11675 (QDX20_11675) | 2594591..2595127 | + | 537 | WP_158524689.1 | GNAT family N-acetyltransferase | - |
QDX20_RS11680 (QDX20_11680) | 2595671..2596396 | + | 726 | WP_279673608.1 | hypothetical protein | - |
QDX20_RS11685 (QDX20_11685) | 2596427..2597590 | - | 1164 | WP_279673098.1 | IS30 family transposase | - |
QDX20_RS11690 (QDX20_11690) | 2597850..2598083 | + | 234 | Protein_2281 | type II toxin-antitoxin system RelE/ParE family toxin | - |
QDX20_RS11695 (QDX20_11695) | 2598089..2598394 | + | 306 | WP_279673609.1 | helix-turn-helix transcriptional regulator | - |
QDX20_RS11700 (QDX20_11700) | 2599039..2599344 | + | 306 | WP_146206324.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15267.47 Da Isoelectric Point: 5.2123
>T277170 WP_110100005.1 NZ_CP122562:2594153-2594578 [Auritidibacter ignavus]
VIILDTNVISEIFRPLPEPRVADWLTSLEGDVAITSVTLAELLAGLRRLPDGRRRDALTRRIDVALAPYRGGRAVLPFDD
VAADRYADVLVARERAGAPISTADAQIAAICLAHGATCATRNVKDFQHTGVELVDPWKVDA
VIILDTNVISEIFRPLPEPRVADWLTSLEGDVAITSVTLAELLAGLRRLPDGRRRDALTRRIDVALAPYRGGRAVLPFDD
VAADRYADVLVARERAGAPISTADAQIAAICLAHGATCATRNVKDFQHTGVELVDPWKVDA
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|