Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 29121..29776 | Replicon | chromosome |
Accession | NZ_CP122561 | ||
Organism | Auritidibacter ignavus strain BABAE-1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QDX25_RS00140 | Protein ID | WP_279672825.1 |
Coordinates | 29351..29776 (+) | Length | 142 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QDX25_RS00135 | Protein ID | WP_110100006.1 |
Coordinates | 29121..29354 (+) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX25_RS00125 (QDX25_00125) | 25386..27593 | - | 2208 | WP_110100192.1 | choline BCCT transporter BetT | - |
QDX25_RS00130 (QDX25_00130) | 27888..28973 | + | 1086 | WP_110100193.1 | redox-regulated ATPase YchF | - |
QDX25_RS00135 (QDX25_00135) | 29121..29354 | + | 234 | WP_110100006.1 | Arc family DNA-binding protein | Antitoxin |
QDX25_RS00140 (QDX25_00140) | 29351..29776 | + | 426 | WP_279672825.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QDX25_RS00145 (QDX25_00145) | 29789..30325 | + | 537 | WP_158524689.1 | GNAT family N-acetyltransferase | - |
QDX25_RS00150 (QDX25_00150) | 30471..30671 | - | 201 | WP_110100196.1 | hypothetical protein | - |
QDX25_RS00155 (QDX25_00155) | 30869..31594 | + | 726 | WP_110100197.1 | hypothetical protein | - |
QDX25_RS00160 (QDX25_00160) | 31819..32052 | + | 234 | Protein_31 | type II toxin-antitoxin system RelE/ParE family toxin | - |
QDX25_RS00165 (QDX25_00165) | 32058..32363 | + | 306 | WP_110100392.1 | helix-turn-helix transcriptional regulator | - |
QDX25_RS00170 (QDX25_00170) | 32732..33106 | + | 375 | WP_146206389.1 | hypothetical protein | - |
QDX25_RS00175 (QDX25_00175) | 33372..34136 | + | 765 | WP_110100200.1 | sulfite exporter TauE/SafE family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15286.43 Da Isoelectric Point: 5.2123
>T277169 WP_279672825.1 NZ_CP122561:29351-29776 [Auritidibacter ignavus]
VIILDTNVISEIFRPLPEPRVADWLTSLEGDVAITSVTLAELLAGLRRLPDGRRRDALTRRIDVALAPYRGGRAVLPFDD
VAADRYADVLVARERAGAQISTADAQTAAICLAHGATCATRNVKDFQHTGVELVDPWKVDA
VIILDTNVISEIFRPLPEPRVADWLTSLEGDVAITSVTLAELLAGLRRLPDGRRRDALTRRIDVALAPYRGGRAVLPFDD
VAADRYADVLVARERAGAQISTADAQTAAICLAHGATCATRNVKDFQHTGVELVDPWKVDA
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|