Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 4782839..4783475 | Replicon | chromosome |
| Accession | NZ_CP122540 | ||
| Organism | Pseudomonas brenneri strain K5-sn1400 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QDY63_RS22015 | Protein ID | WP_032862617.1 |
| Coordinates | 4782839..4783243 (-) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A5B2UU56 |
| Locus tag | QDY63_RS22020 | Protein ID | WP_032862615.1 |
| Coordinates | 4783236..4783475 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY63_RS21995 (QDY63_21995) | 4778890..4780173 | + | 1284 | WP_032861590.1 | ABC transporter substrate-binding protein | - |
| QDY63_RS22000 (QDY63_22000) | 4780653..4781903 | + | 1251 | WP_090291778.1 | ribonucleotide-diphosphate reductase subunit beta | - |
| QDY63_RS22005 (QDY63_22005) | 4781979..4782146 | + | 168 | Protein_4327 | HNH endonuclease | - |
| QDY63_RS22010 (QDY63_22010) | 4782174..4782818 | + | 645 | WP_032862618.1 | HAD-IB family hydrolase | - |
| QDY63_RS22015 (QDY63_22015) | 4782839..4783243 | - | 405 | WP_032862617.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QDY63_RS22020 (QDY63_22020) | 4783236..4783475 | - | 240 | WP_032862615.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QDY63_RS22025 (QDY63_22025) | 4783678..4784628 | + | 951 | WP_032862614.1 | hypothetical protein | - |
| QDY63_RS22030 (QDY63_22030) | 4784753..4785127 | + | 375 | WP_032862613.1 | helix-turn-helix transcriptional regulator | - |
| QDY63_RS22035 (QDY63_22035) | 4785147..4785812 | - | 666 | WP_156356823.1 | hypothetical protein | - |
| QDY63_RS22040 (QDY63_22040) | 4786052..4787107 | - | 1056 | WP_032862612.1 | MBL fold metallo-hydrolase | - |
| QDY63_RS22045 (QDY63_22045) | 4787242..4787865 | + | 624 | WP_032862611.1 | TetR/AcrR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15167.45 Da Isoelectric Point: 7.4666
>T277168 WP_032862617.1 NZ_CP122540:c4783243-4782839 [Pseudomonas brenneri]
MIKYMLDTNIVIYIIKRRPIEILEKFNANVGRLVISSITLAELMHGAEKSQFVERNTRAVEDFTSRLDIIHYDEKAAFHY
GSIRSDLEKKGTPIGVNDLHIASHARSSGLVLVTNNEGEFKRVNGLLVENWIAA
MIKYMLDTNIVIYIIKRRPIEILEKFNANVGRLVISSITLAELMHGAEKSQFVERNTRAVEDFTSRLDIIHYDEKAAFHY
GSIRSDLEKKGTPIGVNDLHIASHARSSGLVLVTNNEGEFKRVNGLLVENWIAA
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|