Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 2019764..2020380 Replicon chromosome
Accession NZ_CP122540
Organism Pseudomonas brenneri strain K5-sn1400

Toxin (Protein)


Gene name hicA Uniprot ID A0A5B2UKX1
Locus tag QDY63_RS09335 Protein ID WP_032859128.1
Coordinates 2019764..2019952 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A5B2UM03
Locus tag QDY63_RS09340 Protein ID WP_032859130.1
Coordinates 2019976..2020380 (+) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDY63_RS09305 (QDY63_09305) 2014861..2015727 + 867 WP_032859115.1 alpha-D-ribose 1-methylphosphonate 5-phosphate C-P-lyase PhnJ -
QDY63_RS09310 (QDY63_09310) 2015688..2016497 + 810 WP_162237639.1 phosphonate C-P lyase system protein PhnK -
QDY63_RS09315 (QDY63_09315) 2016497..2017216 + 720 WP_289345787.1 phosphonate C-P lyase system protein PhnL -
QDY63_RS09320 (QDY63_09320) 2017206..2018336 + 1131 WP_289345495.1 alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase -
QDY63_RS09325 (QDY63_09325) 2018336..2018902 + 567 WP_065943504.1 phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN -
QDY63_RS09330 (QDY63_09330) 2018893..2019642 + 750 WP_032859126.1 phosphonate metabolism protein PhnP -
QDY63_RS09335 (QDY63_09335) 2019764..2019952 + 189 WP_032859128.1 type II toxin-antitoxin system HicA family toxin Toxin
QDY63_RS09340 (QDY63_09340) 2019976..2020380 + 405 WP_032859130.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
QDY63_RS09345 (QDY63_09345) 2020753..2022207 + 1455 WP_289345496.1 M10 family metallopeptidase C-terminal domain-containing protein -
QDY63_RS09350 (QDY63_09350) 2022250..2023446 - 1197 WP_032859132.1 MFS transporter -
QDY63_RS09355 (QDY63_09355) 2023706..2024710 - 1005 WP_032859134.1 sulfate ABC transporter substrate-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(6-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-127)


Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7206.38 Da        Isoelectric Point: 11.4752

>T277166 WP_032859128.1 NZ_CP122540:2019764-2019952 [Pseudomonas brenneri]
VQSRLLIKELQEAGWVLDRVTGSHHIFTHRYNPYTIPVPHPKKDLPLGTVRSIRRRAGLFSF

Download         Length: 189 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14700.71 Da        Isoelectric Point: 4.7285

>AT277166 WP_032859130.1 NZ_CP122540:2019976-2020380 [Pseudomonas brenneri]
MQYPICIEWGDDFTASGIQIPDIPGAVTAGDSFEEAYNAAVEVAHIMLQEMASEGRAIPMPTSVAAHHGNTEYAGMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHKVKSRSSFLADAALEKLVRS

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5B2UKX1

Antitoxin

Source ID Structure
AlphaFold DB A0A5B2UM03

References