Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1740339..1740955 Replicon chromosome
Accession NZ_CP122540
Organism Pseudomonas brenneri strain K5-sn1400

Toxin (Protein)


Gene name hicA Uniprot ID A0A5B2UMH2
Locus tag QDY63_RS07935 Protein ID WP_032857937.1
Coordinates 1740773..1740955 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A5B2UPH5
Locus tag QDY63_RS07930 Protein ID WP_032857941.1
Coordinates 1740339..1740749 (-) Length 137 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDY63_RS07900 (QDY63_07900) 1735928..1736416 - 489 WP_032857953.1 DMT family transporter -
QDY63_RS07905 (QDY63_07905) 1736485..1737411 + 927 WP_032857950.1 LysR family transcriptional regulator -
QDY63_RS07910 (QDY63_07910) 1737481..1738122 + 642 WP_032857947.1 LysE family translocator -
QDY63_RS07915 (QDY63_07915) 1738242..1738769 + 528 WP_032857945.1 DUF4142 domain-containing protein -
QDY63_RS07920 (QDY63_07920) 1738936..1739712 + 777 WP_032858334.1 GNAT family N-acetyltransferase -
QDY63_RS07925 (QDY63_07925) 1739737..1740237 - 501 WP_032857942.1 methylated-DNA--[protein]-cysteine S-methyltransferase -
QDY63_RS07930 (QDY63_07930) 1740339..1740749 - 411 WP_032857941.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
QDY63_RS07935 (QDY63_07935) 1740773..1740955 - 183 WP_032857937.1 type II toxin-antitoxin system HicA family toxin Toxin
QDY63_RS07940 (QDY63_07940) 1741314..1741739 - 426 WP_289345784.1 DUF6216 family protein -
QDY63_RS07945 (QDY63_07945) 1741630..1742175 - 546 WP_289345452.1 DUF6216 family protein -
QDY63_RS07950 (QDY63_07950) 1742348..1743934 - 1587 WP_032857932.1 DUF4041 domain-containing protein -
QDY63_RS07960 (QDY63_07960) 1744609..1745493 - 885 WP_032857929.1 alpha/beta hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(6-57)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-128)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6731.90 Da        Isoelectric Point: 10.7532

>T277165 WP_032857937.1 NZ_CP122540:c1740955-1740773 [Pseudomonas brenneri]
VDSRYLIGHIVADGWYLARVRGSHHHFKHPTKPGLVTIPHPKKDLLDKTAKSILKQALLG

Download         Length: 183 bp

Antitoxin


Download         Length: 137 a.a.        Molecular weight: 14789.72 Da        Isoelectric Point: 4.4807

>AT277165 WP_032857941.1 NZ_CP122540:c1740749-1740339 [Pseudomonas brenneri]
MLYPIAISTGDDNHAWGVEVPDIPGCFSAGDDLDDAMAMAREAIEGHFELLAEDGAPIPSAQKVTLHAANPQYAGCTWAV
VDIDVTKYLGKAQKLNITLPGYLLNRIDEYVLHHPEEKSRSGFLASAALKVLQQER

Download         Length: 411 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5B2UMH2

Antitoxin

Source ID Structure
AlphaFold DB A0A5B2UPH5

References