Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1740339..1740955 | Replicon | chromosome |
| Accession | NZ_CP122540 | ||
| Organism | Pseudomonas brenneri strain K5-sn1400 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A5B2UMH2 |
| Locus tag | QDY63_RS07935 | Protein ID | WP_032857937.1 |
| Coordinates | 1740773..1740955 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A5B2UPH5 |
| Locus tag | QDY63_RS07930 | Protein ID | WP_032857941.1 |
| Coordinates | 1740339..1740749 (-) | Length | 137 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY63_RS07900 (QDY63_07900) | 1735928..1736416 | - | 489 | WP_032857953.1 | DMT family transporter | - |
| QDY63_RS07905 (QDY63_07905) | 1736485..1737411 | + | 927 | WP_032857950.1 | LysR family transcriptional regulator | - |
| QDY63_RS07910 (QDY63_07910) | 1737481..1738122 | + | 642 | WP_032857947.1 | LysE family translocator | - |
| QDY63_RS07915 (QDY63_07915) | 1738242..1738769 | + | 528 | WP_032857945.1 | DUF4142 domain-containing protein | - |
| QDY63_RS07920 (QDY63_07920) | 1738936..1739712 | + | 777 | WP_032858334.1 | GNAT family N-acetyltransferase | - |
| QDY63_RS07925 (QDY63_07925) | 1739737..1740237 | - | 501 | WP_032857942.1 | methylated-DNA--[protein]-cysteine S-methyltransferase | - |
| QDY63_RS07930 (QDY63_07930) | 1740339..1740749 | - | 411 | WP_032857941.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QDY63_RS07935 (QDY63_07935) | 1740773..1740955 | - | 183 | WP_032857937.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QDY63_RS07940 (QDY63_07940) | 1741314..1741739 | - | 426 | WP_289345784.1 | DUF6216 family protein | - |
| QDY63_RS07945 (QDY63_07945) | 1741630..1742175 | - | 546 | WP_289345452.1 | DUF6216 family protein | - |
| QDY63_RS07950 (QDY63_07950) | 1742348..1743934 | - | 1587 | WP_032857932.1 | DUF4041 domain-containing protein | - |
| QDY63_RS07960 (QDY63_07960) | 1744609..1745493 | - | 885 | WP_032857929.1 | alpha/beta hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6731.90 Da Isoelectric Point: 10.7532
>T277165 WP_032857937.1 NZ_CP122540:c1740955-1740773 [Pseudomonas brenneri]
VDSRYLIGHIVADGWYLARVRGSHHHFKHPTKPGLVTIPHPKKDLLDKTAKSILKQALLG
VDSRYLIGHIVADGWYLARVRGSHHHFKHPTKPGLVTIPHPKKDLLDKTAKSILKQALLG
Download Length: 183 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 14789.72 Da Isoelectric Point: 4.4807
>AT277165 WP_032857941.1 NZ_CP122540:c1740749-1740339 [Pseudomonas brenneri]
MLYPIAISTGDDNHAWGVEVPDIPGCFSAGDDLDDAMAMAREAIEGHFELLAEDGAPIPSAQKVTLHAANPQYAGCTWAV
VDIDVTKYLGKAQKLNITLPGYLLNRIDEYVLHHPEEKSRSGFLASAALKVLQQER
MLYPIAISTGDDNHAWGVEVPDIPGCFSAGDDLDDAMAMAREAIEGHFELLAEDGAPIPSAQKVTLHAANPQYAGCTWAV
VDIDVTKYLGKAQKLNITLPGYLLNRIDEYVLHHPEEKSRSGFLASAALKVLQQER
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5B2UMH2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5B2UPH5 |