Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 22499..23021 Replicon plasmid pSCMY3
Accession NZ_CP122520
Organism Escherichia coli strain MY1-8

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag QCL60_RS24330 Protein ID WP_000220560.1
Coordinates 22740..23021 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag QCL60_RS24325 Protein ID WP_000121743.1
Coordinates 22499..22750 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QCL60_RS24295 (QCL60_24290) 17862..18092 + 231 WP_000051064.1 plasmid partition protein ParG -
QCL60_RS24300 (QCL60_24295) 18108..18401 + 294 WP_015060510.1 hypothetical protein -
QCL60_RS24305 (QCL60_24300) 18403..19371 + 969 WP_166501310.1 IS5-like element IS903B family transposase -
QCL60_RS24310 (QCL60_24305) 19431..19784 - 354 WP_000876434.1 DNA distortion polypeptide 3 -
QCL60_RS24315 (QCL60_24310) 19921..20367 - 447 WP_001074386.1 hypothetical protein -
QCL60_RS24320 (QCL60_24315) 20407..21243 - 837 WP_001050931.1 RepB family plasmid replication initiator protein -
QCL60_RS24325 (QCL60_24320) 22499..22750 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
QCL60_RS24330 (QCL60_24325) 22740..23021 + 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QCL60_RS24335 (QCL60_24330) 23167..23490 + 324 WP_001181903.1 hypothetical protein -
QCL60_RS24340 (QCL60_24335) 23535..23780 + 246 WP_000356546.1 hypothetical protein -
QCL60_RS24345 (QCL60_24340) 23770..23985 + 216 WP_001180116.1 hypothetical protein -
QCL60_RS24350 (QCL60_24345) 24078..24407 + 330 WP_000866648.1 hypothetical protein -
QCL60_RS24355 (QCL60_24350) 24694..24843 + 150 WP_000003880.1 hypothetical protein -
QCL60_RS24360 (QCL60_24355) 24856..25128 + 273 WP_000160399.1 hypothetical protein -
QCL60_RS24365 (QCL60_24360) 25455..26000 + 546 WP_038976855.1 DNA distortion polypeptide 1 -
QCL60_RS24370 (QCL60_24365) 26003..27160 + 1158 WP_000538023.1 DNA distortion polypeptide 2 -
QCL60_RS24375 (QCL60_24370) 27521..28012 + 492 WP_000872475.1 transcription termination/antitermination NusG family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(A) / floR / tet(X4) / lnu(F) / aadA2 / blaSHV-12 - 1..54392 54392


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T277163 WP_000220560.1 NZ_CP122520:22740-23021 [Escherichia coli]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT277163 WP_000121743.1 NZ_CP122520:22499-22750 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References