Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 4158804..4159399 | Replicon | chromosome |
| Accession | NZ_CP122517 | ||
| Organism | Escherichia coli strain MY1-8 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | U9Y4M4 |
| Locus tag | QCL60_RS20090 | Protein ID | WP_000239579.1 |
| Coordinates | 4158804..4159154 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | U9Y2K1 |
| Locus tag | QCL60_RS20095 | Protein ID | WP_001223208.1 |
| Coordinates | 4159148..4159399 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QCL60_RS20070 (4154080) | 4154080..4155102 | - | 1023 | WP_001517822.1 | ABC transporter permease | - |
| QCL60_RS20075 (4155116) | 4155116..4156618 | - | 1503 | WP_000205793.1 | sugar ABC transporter ATP-binding protein | - |
| QCL60_RS20080 (4156928) | 4156928..4157884 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| QCL60_RS20085 (4158194) | 4158194..4158724 | + | 531 | WP_000055072.1 | inorganic diphosphatase | - |
| QCL60_RS20090 (4158804) | 4158804..4159154 | - | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
| QCL60_RS20095 (4159148) | 4159148..4159399 | - | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
| QCL60_RS20100 (4159612) | 4159612..4159953 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
| QCL60_RS20105 (4159956) | 4159956..4163735 | - | 3780 | WP_000060901.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T277152 WP_000239579.1 NZ_CP122517:c4159154-4158804 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0Y8A8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LQ26 |