Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
| Location | 3521098..3521935 | Replicon | chromosome |
| Accession | NZ_CP122517 | ||
| Organism | Escherichia coli strain MY1-8 | ||
Toxin (Protein)
| Gene name | itaT | Uniprot ID | Q3Z4X7 |
| Locus tag | QCL60_RS17125 | Protein ID | WP_000227784.1 |
| Coordinates | 3521393..3521935 (+) | Length | 181 a.a. |
Antitoxin (Protein)
| Gene name | itaR | Uniprot ID | I2UQS9 |
| Locus tag | QCL60_RS17120 | Protein ID | WP_001297137.1 |
| Coordinates | 3521098..3521409 (+) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QCL60_RS17095 (3516118) | 3516118..3517065 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
| QCL60_RS17100 (3517087) | 3517087..3519078 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
| QCL60_RS17105 (3519068) | 3519068..3519682 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
| QCL60_RS17110 (3519682) | 3519682..3520011 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
| QCL60_RS17115 (3520023) | 3520023..3520913 | + | 891 | WP_000971336.1 | heme o synthase | - |
| QCL60_RS17120 (3521098) | 3521098..3521409 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
| QCL60_RS17125 (3521393) | 3521393..3521935 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
| QCL60_RS17130 (3521991) | 3521991..3522926 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
| QCL60_RS17135 (3523334) | 3523334..3524698 | + | 1365 | WP_001000999.1 | MFS transporter | - |
| QCL60_RS17140 (3524826) | 3524826..3525317 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
| QCL60_RS17145 (3525485) | 3525485..3526396 | + | 912 | WP_000705847.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T277150 WP_000227784.1 NZ_CP122517:3521393-3521935 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|