Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2430299..2430937 | Replicon | chromosome |
Accession | NZ_CP122517 | ||
Organism | Escherichia coli strain MY1-8 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | QCL60_RS11660 | Protein ID | WP_000813794.1 |
Coordinates | 2430761..2430937 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QCL60_RS11655 | Protein ID | WP_001270286.1 |
Coordinates | 2430299..2430715 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCL60_RS11635 (2425451) | 2425451..2426392 | - | 942 | WP_001517961.1 | ABC transporter permease | - |
QCL60_RS11640 (2426393) | 2426393..2427406 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
QCL60_RS11645 (2427424) | 2427424..2428569 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
QCL60_RS11650 (2428814) | 2428814..2430220 | - | 1407 | WP_000760629.1 | PLP-dependent aminotransferase family protein | - |
QCL60_RS11655 (2430299) | 2430299..2430715 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
QCL60_RS11660 (2430761) | 2430761..2430937 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
QCL60_RS11665 (2431159) | 2431159..2431389 | + | 231 | WP_000494244.1 | YncJ family protein | - |
QCL60_RS11670 (2431481) | 2431481..2433442 | - | 1962 | WP_001307191.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
QCL60_RS11675 (2433515) | 2433515..2434051 | - | 537 | WP_000429141.1 | DNA-binding transcriptional regulator SutR | - |
QCL60_RS11680 (2434143) | 2434143..2435318 | + | 1176 | WP_001236319.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2435358..2436623 | 1265 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T277147 WP_000813794.1 NZ_CP122517:c2430937-2430761 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT277147 WP_001270286.1 NZ_CP122517:c2430715-2430299 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|