Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1344142..1344767 | Replicon | chromosome |
Accession | NZ_CP122517 | ||
Organism | Escherichia coli strain MY1-8 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QCL60_RS06570 | Protein ID | WP_000911330.1 |
Coordinates | 1344369..1344767 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | QCL60_RS06565 | Protein ID | WP_000450524.1 |
Coordinates | 1344142..1344369 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCL60_RS06540 (1339945) | 1339945..1340415 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
QCL60_RS06545 (1340415) | 1340415..1340987 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
QCL60_RS06550 (1341133) | 1341133..1342011 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
QCL60_RS06555 (1342028) | 1342028..1343062 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
QCL60_RS06560 (1343275) | 1343275..1343988 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
QCL60_RS06565 (1344142) | 1344142..1344369 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
QCL60_RS06570 (1344369) | 1344369..1344767 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QCL60_RS06575 (1344914) | 1344914..1345777 | + | 864 | WP_001267508.1 | neutral zinc metallopeptidase | - |
QCL60_RS06580 (1345792) | 1345792..1347807 | + | 2016 | WP_000829329.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
QCL60_RS06585 (1347881) | 1347881..1348579 | + | 699 | WP_000679823.1 | esterase | - |
QCL60_RS06590 (1348689) | 1348689..1348889 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T277140 WP_000911330.1 NZ_CP122517:1344369-1344767 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|