Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ(toxin) |
Location | 1145747..1146371 | Replicon | chromosome |
Accession | NZ_CP122515 | ||
Organism | Helicobacter pylori strain HP22 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A2A6UH71 |
Locus tag | QCM05_RS05590 | Protein ID | WP_025455067.1 |
Coordinates | 1146105..1146371 (+) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | QCM05_RS05585 | Protein ID | WP_279962694.1 |
Coordinates | 1145747..1146124 (+) | Length | 126 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCM05_RS05560 (QCM05_05560) | 1140965..1142077 | + | 1113 | WP_279962692.1 | hydrogenase formation protein HypD | - |
QCM05_RS05565 (QCM05_05565) | 1142028..1142688 | - | 661 | Protein_1073 | hypothetical protein | - |
QCM05_RS05580 (QCM05_05580) | 1143061..1145286 | + | 2226 | WP_279962693.1 | Hop family adhesin BabA | - |
QCM05_RS05585 (QCM05_05585) | 1145747..1146124 | + | 378 | WP_279962694.1 | hypothetical protein | Antitoxin |
QCM05_RS05590 (QCM05_05590) | 1146105..1146371 | + | 267 | WP_025455067.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
QCM05_RS05595 (QCM05_05595) | 1146476..1147000 | - | 525 | WP_279962696.1 | acyl-CoA thioesterase | - |
QCM05_RS05600 (QCM05_05600) | 1147147..1147995 | + | 849 | WP_279962697.1 | SDR family oxidoreductase | - |
QCM05_RS05605 (QCM05_05605) | 1147988..1148968 | + | 981 | WP_279962699.1 | iron ABC transporter permease | - |
QCM05_RS05610 (QCM05_05610) | 1148968..1149735 | + | 768 | WP_024422093.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10303.17 Da Isoelectric Point: 9.6292
>T277133 WP_025455067.1 NZ_CP122515:1146105-1146371 [Helicobacter pylori]
VLKLNLKKSFQKDFDKLLLNGFDDSVLNKVILSLRKKEPLDPQFQDHALKGKWKPFRECHIKADILLVYLVKDDELILVR
LGSHSELF
VLKLNLKKSFQKDFDKLLLNGFDDSVLNKVILSLRKKEPLDPQFQDHALKGKWKPFRECHIKADILLVYLVKDDELILVR
LGSHSELF
Download Length: 267 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 14832.90 Da Isoelectric Point: 9.0112
>AT277133 WP_279962694.1 NZ_CP122515:1145747-1146124 [Helicobacter pylori]
MPNSPTKKDYTRYSEKQLFNLINQLERKIKKMQNDRASFKEKMAKELEKRDQNFKDKIDALNELLQKISQAFDDKRDCCL
GRKIPNLETQQAMRDVLNKETDLIVEDFSSYSDERKRVLGVETQP
MPNSPTKKDYTRYSEKQLFNLINQLERKIKKMQNDRASFKEKMAKELEKRDQNFKDKIDALNELLQKISQAFDDKRDCCL
GRKIPNLETQQAMRDVLNKETDLIVEDFSSYSDERKRVLGVETQP
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|