Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 20710..21232 Replicon plasmid unnamed5
Accession NZ_CP122512
Organism Escherichia coli strain W444

Toxin (Protein)


Gene name relE Uniprot ID U9YLU1
Locus tag QC806_RS26700 Protein ID WP_000638823.1
Coordinates 20951..21232 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID U9Y7J1
Locus tag QC806_RS26695 Protein ID WP_000121741.1
Coordinates 20710..20961 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QC806_RS26640 15799..16242 + 444 WP_000964330.1 NfeD family protein -
QC806_RS26645 16246..16416 + 171 WP_000550720.1 hypothetical protein -
QC806_RS26650 16427..16873 + 447 WP_001243165.1 hypothetical protein -
QC806_RS26655 16906..17163 + 258 WP_001542015.1 hypothetical protein -
QC806_RS26660 17144..17446 + 303 WP_001360345.1 hypothetical protein -
QC806_RS26665 17443..17700 + 258 WP_000739144.1 hypothetical protein -
QC806_RS26670 17704..18699 + 996 WP_001028543.1 type IV secretion system protein -
QC806_RS26675 18705..19346 + 642 WP_001425343.1 type IV secretion system protein -
QC806_RS26680 19348..19602 + 255 WP_001043555.1 EexN family lipoprotein -
QC806_RS26685 19615..19902 + 288 WP_001032611.1 EexN family lipoprotein -
QC806_RS26690 19975..20610 + 636 WP_015059536.1 hypothetical protein -
QC806_RS26695 20710..20961 + 252 WP_000121741.1 hypothetical protein Antitoxin
QC806_RS26700 20951..21232 + 282 WP_000638823.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QC806_RS26705 21300..21599 + 300 WP_000835764.1 TrbM/KikA/MpfK family conjugal transfer protein -
QC806_RS26710 21602..22837 + 1236 WP_015059538.1 TcpQ domain-containing protein -
QC806_RS26715 22843..23280 + 438 WP_000539665.1 type IV pilus biogenesis protein PilM -
QC806_RS26720 23399..23797 + 399 WP_001153665.1 hypothetical protein -
QC806_RS26725 23818..24402 + 585 WP_001177113.1 lytic transglycosylase domain-containing protein -
QC806_RS26730 24402..24692 + 291 WP_000865479.1 conjugal transfer protein -
QC806_RS26735 24763..25083 + 321 WP_000362080.1 VirB3 family type IV secretion system protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid mcr-1.1 - 1..61853 61853


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-87)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10945.79 Da        Isoelectric Point: 10.4997

>T277130 WP_000638823.1 NZ_CP122512:20951-21232 [Escherichia coli]
MIYELAFDHRALKEWQKLGHTVREQFKKKLSERLINPRVPAAKLHGHTDRYKIKLRASGYRLVYQVIDEKVVLLVISVGK
REGSDVYHMADTR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9223.38 Da        Isoelectric Point: 3.9823

>AT277130 WP_000121741.1 NZ_CP122512:20710-20961 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPELYAYYRELAEDAELNAIADERMKNPDIVRVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9YLU1

Antitoxin

Source ID Structure
AlphaFold DB U9Y7J1

References