277129

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/Xre(antitoxin)
Location 4944..5445 Replicon plasmid unnamed5
Accession NZ_CP122512
Organism Escherichia coli strain W444

Toxin (Protein)


Gene name TsxA Uniprot ID H1ZXU8
Locus tag QC806_RS26555 Protein ID WP_000702247.1
Coordinates 5185..5445 (-) Length 87 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID -
Locus tag QC806_RS26550 Protein ID WP_001132407.1
Coordinates 4944..5195 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QC806_RS26510 1..753 + 753 WP_000797966.1 conjugal transfer protein TraL -
QC806_RS26515 755..1462 + 708 WP_021503228.1 hypothetical protein -
QC806_RS26520 1482..1808 + 327 WP_063078684.1 hypothetical protein -
QC806_RS26525 1939..2376 - 438 WP_000466318.1 type II toxin-antitoxin system HicB family antitoxin -
QC806_RS26530 2401..2583 - 183 WP_000833470.1 type II toxin-antitoxin system HicA family toxin -
QC806_RS26535 2880..3323 + 444 WP_000068545.1 hypothetical protein -
QC806_RS26540 3430..3696 - 267 WP_000681608.1 type II toxin-antitoxin system HicB family antitoxin -
QC806_RS26545 4116..4394 - 279 WP_000545938.1 hypothetical protein -
QC806_RS26550 4944..5195 - 252 WP_001132407.1 transcriptional regulator Antitoxin
QC806_RS26555 5185..5445 - 261 WP_000702247.1 hypothetical protein Toxin
QC806_RS26560 5497..5721 - 225 WP_000814381.1 hypothetical protein -
QC806_RS26565 5818..6027 - 210 WP_000866036.1 hypothetical protein -
QC806_RS26570 6069..6392 - 324 WP_000427403.1 hypothetical protein -
QC806_RS26575 6719..6865 + 147 WP_001356709.1 hypothetical protein -
QC806_RS26580 6974..7303 - 330 WP_000855120.1 hypothetical protein -
QC806_RS26585 7901..8566 + 666 WP_000532148.1 division plane positioning ATPase MipZ -
QC806_RS26590 8640..8924 + 285 WP_001162371.1 hypothetical protein -
QC806_RS26595 8942..9538 - 597 WP_000125165.1 ProQ/FINO family protein -
QC806_RS26600 9688..9810 - 123 WP_223170659.1 type I toxin-antitoxin system Hok family toxin -
QC806_RS26605 9755..9907 - 153 Protein_19 DUF5431 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid mcr-1.1 - 1..61853 61853


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-37)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 9817.29 Da        Isoelectric Point: 10.0665

>T277129 WP_000702247.1 NZ_CP122512:c5445-5185 [Escherichia coli]
MKIRKGDRQYYLNKEGDTFHLVKRVKTFSKSATLGKTKATVKTVADLVFHEKAFDTIDFASDGLRENDKEIVSMMIQEMS
EGKNAK

Download         Length: 261 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9404.77 Da        Isoelectric Point: 9.8120

>AT277129 WP_001132407.1 NZ_CP122512:c5195-4944 [Escherichia coli]
MPNENTPENIKRLRQKIGLTQKECAEIFSMSPRTWRRKEEPVGTASGTALTPVEFKFLLLLAGEHPDYVLCKRNKKNSDS
GSN

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1P8DNC0

Antitoxin

Source ID Structure

References