Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 43889..44414 | Replicon | plasmid unnamed2 |
Accession | NZ_CP122509 | ||
Organism | Escherichia coli strain W444 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | QC806_RS24865 | Protein ID | WP_001159868.1 |
Coordinates | 44109..44414 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | QC806_RS24860 | Protein ID | WP_000813634.1 |
Coordinates | 43889..44107 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QC806_RS24835 (39015) | 39015..39641 | + | 627 | Protein_47 | hypothetical protein | - |
QC806_RS24840 (39814) | 39814..41013 | - | 1200 | WP_000948429.1 | IS91 family transposase | - |
QC806_RS24845 (41023) | 41023..41211 | - | 189 | WP_000957857.1 | hypothetical protein | - |
QC806_RS24850 (41643) | 41643..42776 | + | 1134 | WP_001542067.1 | DUF3800 domain-containing protein | - |
QC806_RS24855 (42810) | 42810..43322 | - | 513 | WP_000151784.1 | hypothetical protein | - |
QC806_RS24860 (43889) | 43889..44107 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
QC806_RS24865 (44109) | 44109..44414 | + | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
QC806_RS24870 (44415) | 44415..45221 | + | 807 | WP_284632204.1 | site-specific integrase | - |
QC806_RS24875 (45995) | 45995..46750 | + | 756 | WP_000852146.1 | replication initiation protein RepE | - |
QC806_RS24880 (47338) | 47338..48504 | + | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaTEM-1B / rmtB / erm(B) / mph(A) / aph(3'')-Ib / aph(6)-Id / tet(A) / floR | - | 1..121553 | 121553 | |
- | flank | IS/Tn | - | - | 39814..41013 | 1199 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T277121 WP_001159868.1 NZ_CP122509:44109-44414 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|