Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 37594..38237 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP122509 | ||
| Organism | Escherichia coli strain W444 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | C7S9Y5 |
| Locus tag | QC806_RS24820 | Protein ID | WP_001034046.1 |
| Coordinates | 37594..38010 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | V0SR71 |
| Locus tag | QC806_RS24825 | Protein ID | WP_001261278.1 |
| Coordinates | 38007..38237 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QC806_RS24805 (32731) | 32731..33147 | - | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | - |
| QC806_RS24810 (33144) | 33144..33374 | - | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| QC806_RS24815 (33755) | 33755..37549 | + | 3795 | WP_001144732.1 | hypothetical protein | - |
| QC806_RS24820 (37594) | 37594..38010 | - | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QC806_RS24825 (38007) | 38007..38237 | - | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QC806_RS24830 (38502) | 38502..39002 | + | 501 | WP_000528931.1 | HEPN family nuclease | - |
| QC806_RS24835 (39015) | 39015..39641 | + | 627 | Protein_47 | hypothetical protein | - |
| QC806_RS24840 (39814) | 39814..41013 | - | 1200 | WP_000948429.1 | IS91 family transposase | - |
| QC806_RS24845 (41023) | 41023..41211 | - | 189 | WP_000957857.1 | hypothetical protein | - |
| QC806_RS24850 (41643) | 41643..42776 | + | 1134 | WP_001542067.1 | DUF3800 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / rmtB / erm(B) / mph(A) / aph(3'')-Ib / aph(6)-Id / tet(A) / floR | - | 1..121553 | 121553 | |
| - | flank | IS/Tn | - | - | 39814..41013 | 1199 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14978.31 Da Isoelectric Point: 6.7113
>T277120 WP_001034046.1 NZ_CP122509:c38010-37594 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9NXF9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0SR71 |