Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 37594..38237 Replicon plasmid unnamed2
Accession NZ_CP122509
Organism Escherichia coli strain W444

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag QC806_RS24820 Protein ID WP_001034046.1
Coordinates 37594..38010 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag QC806_RS24825 Protein ID WP_001261278.1
Coordinates 38007..38237 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QC806_RS24805 (32731) 32731..33147 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -
QC806_RS24810 (33144) 33144..33374 - 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
QC806_RS24815 (33755) 33755..37549 + 3795 WP_001144732.1 hypothetical protein -
QC806_RS24820 (37594) 37594..38010 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
QC806_RS24825 (38007) 38007..38237 - 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QC806_RS24830 (38502) 38502..39002 + 501 WP_000528931.1 HEPN family nuclease -
QC806_RS24835 (39015) 39015..39641 + 627 Protein_47 hypothetical protein -
QC806_RS24840 (39814) 39814..41013 - 1200 WP_000948429.1 IS91 family transposase -
QC806_RS24845 (41023) 41023..41211 - 189 WP_000957857.1 hypothetical protein -
QC806_RS24850 (41643) 41643..42776 + 1134 WP_001542067.1 DUF3800 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1B / rmtB / erm(B) / mph(A) / aph(3'')-Ib / aph(6)-Id / tet(A) / floR - 1..121553 121553
- flank IS/Tn - - 39814..41013 1199


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T277120 WP_001034046.1 NZ_CP122509:c38010-37594 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT277120 WP_001261278.1 NZ_CP122509:c38237-38007 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References