Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 32731..33374 | Replicon | plasmid unnamed2 |
Accession | NZ_CP122509 | ||
Organism | Escherichia coli strain W444 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | V0UN72 |
Locus tag | QC806_RS24805 | Protein ID | WP_001034044.1 |
Coordinates | 32731..33147 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B1P7N7 |
Locus tag | QC806_RS24810 | Protein ID | WP_001261286.1 |
Coordinates | 33144..33374 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QC806_RS24785 (28793) | 28793..29077 | + | 285 | Protein_37 | IS21 family transposase | - |
QC806_RS24790 (29133) | 29133..29830 | + | 698 | WP_223155668.1 | IS1-like element IS1A family transposase | - |
QC806_RS24795 (30084) | 30084..31106 | - | 1023 | WP_000361402.1 | helicase UvrD | - |
QC806_RS24800 (31091) | 31091..32656 | - | 1566 | WP_001128474.1 | AAA family ATPase | - |
QC806_RS24805 (32731) | 32731..33147 | - | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QC806_RS24810 (33144) | 33144..33374 | - | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QC806_RS24815 (33755) | 33755..37549 | + | 3795 | WP_001144732.1 | hypothetical protein | - |
QC806_RS24820 (37594) | 37594..38010 | - | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
QC806_RS24825 (38007) | 38007..38237 | - | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaTEM-1B / rmtB / erm(B) / mph(A) / aph(3'')-Ib / aph(6)-Id / tet(A) / floR | - | 1..121553 | 121553 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T277119 WP_001034044.1 NZ_CP122509:c33147-32731 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CHW1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CKZ6 |