Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 153453..154096 Replicon plasmid unnamed1
Accession NZ_CP122508
Organism Escherichia coli strain W444

Toxin (Protein)


Gene name vagD Uniprot ID B1LRW4
Locus tag QC806_RS24085 Protein ID WP_001044768.1
Coordinates 153680..154096 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D2WFK3
Locus tag QC806_RS24080 Protein ID WP_001261287.1
Coordinates 153453..153683 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QC806_RS24045 148738..150432 - 1695 WP_000105636.1 mercury(II) reductase -
QC806_RS24050 150484..150906 - 423 WP_001340589.1 organomercurial transporter MerC -
QC806_RS24055 150942..151217 - 276 WP_000732292.1 mercury resistance system periplasmic binding protein MerP -
QC806_RS24060 151231..151581 - 351 WP_001294663.1 mercuric transport protein MerT -
QC806_RS24065 151653..152087 + 435 WP_000429836.1 Hg(II)-responsive transcriptional regulator -
QC806_RS24070 152134..152838 - 705 WP_001067858.1 IS6-like element IS26 family transposase -
QC806_RS24075 152885..153157 - 273 WP_061602529.1 hypothetical protein -
QC806_RS24080 153453..153683 + 231 WP_001261287.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QC806_RS24085 153680..154096 + 417 WP_001044768.1 type II toxin-antitoxin system VapC family toxin Toxin
QC806_RS24090 154258..156396 - 2139 WP_000350638.1 AAA family ATPase -
QC806_RS24095 156750..157007 + 258 WP_000343085.1 hypothetical protein -
QC806_RS24100 157007..157597 + 591 WP_000194575.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / qnrS1 / dfrA12 / aadA2 / cmlA1 / ant(3'')-Ia / sul3 / mef(B) / aph(3')-Ia - 1..247590 247590


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15197.66 Da        Isoelectric Point: 7.7805

>T277117 WP_001044768.1 NZ_CP122508:153680-154096 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8815.90 Da        Isoelectric Point: 4.3775

>AT277117 WP_001261287.1 NZ_CP122508:153453-153683 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLEYEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A606Q844

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9QFC4

References