Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4270153..4270988 | Replicon | chromosome |
| Accession | NZ_CP122507 | ||
| Organism | Escherichia coli strain W444 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | QC806_RS21010 | Protein ID | WP_057109034.1 |
| Coordinates | 4270611..4270988 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1E5MC43 |
| Locus tag | QC806_RS21005 | Protein ID | WP_063112944.1 |
| Coordinates | 4270153..4270521 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QC806_RS20965 (4265505) | 4265505..4266185 | + | 681 | WP_001282919.1 | WYL domain-containing protein | - |
| QC806_RS20970 (4266333) | 4266333..4267010 | + | 678 | WP_063073422.1 | hypothetical protein | - |
| QC806_RS20975 (4267016) | 4267016..4267168 | + | 153 | WP_001696589.1 | DUF905 family protein | - |
| QC806_RS20980 (4267269) | 4267269..4268087 | + | 819 | WP_096211214.1 | DUF932 domain-containing protein | - |
| QC806_RS20985 (4268179) | 4268179..4268664 | + | 486 | WP_000213716.1 | antirestriction protein | - |
| QC806_RS20990 (4268680) | 4268680..4269156 | + | 477 | WP_001186780.1 | RadC family protein | - |
| QC806_RS20995 (4269219) | 4269219..4269440 | + | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| QC806_RS21000 (4269459) | 4269459..4270103 | + | 645 | WP_045146861.1 | hypothetical protein | - |
| QC806_RS21005 (4270153) | 4270153..4270521 | + | 369 | WP_063112944.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QC806_RS21010 (4270611) | 4270611..4270988 | + | 378 | WP_057109034.1 | TA system toxin CbtA family protein | Toxin |
| QC806_RS21015 (4270985) | 4270985..4271134 | + | 150 | Protein_4107 | DUF5983 family protein | - |
| QC806_RS21020 (4271210) | 4271210..4271407 | + | 198 | WP_023563519.1 | DUF957 domain-containing protein | - |
| QC806_RS21025 (4271492) | 4271492..4272334 | + | 843 | WP_001529559.1 | DUF4942 domain-containing protein | - |
| QC806_RS21030 (4273083) | 4273083..4274621 | + | 1539 | WP_072665252.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4246454..4282434 | 35980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13934.86 Da Isoelectric Point: 6.8517
>T277114 WP_057109034.1 NZ_CP122507:4270611-4270988 [Escherichia coli]
MKTLPDTHVREASCCPSPVTIWQTLLTRLLDQHYGLALNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKQ
MKTLPDTHVREASCCPSPVTIWQTLLTRLLDQHYGLALNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13724.52 Da Isoelectric Point: 6.8270
>AT277114 WP_063112944.1 NZ_CP122507:4270153-4270521 [Escherichia coli]
VSDTLPGTTHHDDNHDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLPGTTHHDDNHDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|