Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 4211176..4211774 | Replicon | chromosome |
| Accession | NZ_CP122507 | ||
| Organism | Escherichia coli strain W444 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | A0A8T6PRV3 |
| Locus tag | QC806_RS20765 | Protein ID | WP_053291281.1 |
| Coordinates | 4211176..4211553 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | L4J1C0 |
| Locus tag | QC806_RS20770 | Protein ID | WP_001603498.1 |
| Coordinates | 4211553..4211774 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QC806_RS20735 (4206400) | 4206400..4206738 | + | 339 | WP_000883400.1 | divalent cation tolerance protein CutA | - |
| QC806_RS20740 (4206714) | 4206714..4208411 | + | 1698 | WP_000068922.1 | protein-disulfide reductase DsbD | - |
| QC806_RS20745 (4208448) | 4208448..4209023 | + | 576 | WP_001188520.1 | transcriptional regulator | - |
| QC806_RS20755 (4209403) | 4209403..4210665 | + | 1263 | WP_096263470.1 | integrase arm-type DNA-binding domain-containing protein | - |
| QC806_RS20760 (4210851) | 4210851..4211066 | + | 216 | Protein_4056 | transposase | - |
| QC806_RS20765 (4211176) | 4211176..4211553 | - | 378 | WP_053291281.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| QC806_RS20770 (4211553) | 4211553..4211774 | - | 222 | WP_001603498.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QC806_RS20775 (4211959) | 4211959..4212978 | - | 1020 | WP_219398756.1 | fimbrial protein | - |
| QC806_RS20780 (4212990) | 4212990..4215476 | - | 2487 | WP_096261919.1 | fimbrial biogenesis outer membrane usher protein | - |
| QC806_RS20785 (4215494) | 4215494..4216174 | - | 681 | WP_063100857.1 | fimbrial assembly chaperone | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4210851..4224201 | 13350 | |
| - | flank | IS/Tn | - | - | 4210851..4211132 | 281 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13487.28 Da Isoelectric Point: 6.2257
>T277113 WP_053291281.1 NZ_CP122507:c4211553-4211176 [Escherichia coli]
MRHISPEELIAIHDANISRYGGLPGMPDSGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVYDSPELAELTVGAATGEVSVSTVVATLRRLYGTA
MRHISPEELIAIHDANISRYGGLPGMPDSGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVYDSPELAELTVGAATGEVSVSTVVATLRRLYGTA
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|