Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2294168..2294806 | Replicon | chromosome |
| Accession | NZ_CP122507 | ||
| Organism | Escherichia coli strain W444 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | QC806_RS11345 | Protein ID | WP_000813794.1 |
| Coordinates | 2294168..2294344 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | QC806_RS11350 | Protein ID | WP_001270286.1 |
| Coordinates | 2294390..2294806 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QC806_RS11325 (2289787) | 2289787..2290962 | - | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
| QC806_RS11330 (2291054) | 2291054..2291590 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| QC806_RS11335 (2291663) | 2291663..2293624 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| QC806_RS11340 (2293716) | 2293716..2293946 | - | 231 | WP_000494244.1 | YncJ family protein | - |
| QC806_RS11345 (2294168) | 2294168..2294344 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| QC806_RS11350 (2294390) | 2294390..2294806 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| QC806_RS11355 (2294885) | 2294885..2296291 | + | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
| QC806_RS11360 (2296536) | 2296536..2297681 | + | 1146 | WP_000047418.1 | ABC transporter substrate-binding protein | - |
| QC806_RS11365 (2297699) | 2297699..2298712 | + | 1014 | WP_000220393.1 | ABC transporter ATP-binding protein | - |
| QC806_RS11370 (2298713) | 2298713..2299654 | + | 942 | WP_152914928.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T277107 WP_000813794.1 NZ_CP122507:2294168-2294344 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT277107 WP_001270286.1 NZ_CP122507:2294390-2294806 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|