277095

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 35204..35697 Replicon plasmid unnamed3
Accession NZ_CP122506
Organism Escherichia coli strain W619

Toxin (Protein)


Gene name TsxA Uniprot ID U9Y9W8
Locus tag QC808_RS24720 Protein ID WP_001230709.1
Coordinates 35443..35697 (-) Length 85 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID U9Y4R8
Locus tag QC808_RS24715 Protein ID WP_000151456.1
Coordinates 35204..35446 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QC808_RS24685 30527..30820 - 294 WP_000954637.1 hypothetical protein -
QC808_RS24690 30835..31209 - 375 WP_015387341.1 hypothetical protein -
QC808_RS24695 31261..31548 - 288 WP_000673430.1 hypothetical protein -
QC808_RS24700 32298..33560 + 1263 WP_000608644.1 IS1380-like element ISEcp1 family transposase -
QC808_RS24705 33813..34688 + 876 WP_015387340.1 extended-spectrum class A beta-lactamase CTX-M-55 -
QC808_RS24710 34735..35079 - 345 Protein_40 WbuC family cupin fold metalloprotein -
QC808_RS24715 35204..35446 - 243 WP_000151456.1 hypothetical protein Antitoxin
QC808_RS24720 35443..35697 - 255 WP_001230709.1 hypothetical protein Toxin
QC808_RS24725 35694..36236 - 543 WP_001083904.1 hypothetical protein -
QC808_RS24730 36340..36855 - 516 WP_001025393.1 J domain-containing protein -
QC808_RS24735 37259..37588 - 330 WP_000855119.1 hypothetical protein -
QC808_RS24740 38175..38840 + 666 WP_015387337.1 division plane positioning ATPase MipZ -
QC808_RS24745 38914..39198 + 285 WP_001162371.1 hypothetical protein -
QC808_RS24750 39216..39812 - 597 WP_000125165.1 ProQ/FINO family protein -
QC808_RS24755 39961..40083 - 123 WP_223202818.1 Hok/Gef family protein -
QC808_RS24760 40031..40177 - 147 Protein_50 DUF5431 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaCTX-M-55 - 1..66482 66482
- flank IS/Tn blaCTX-M-55 - 32298..34688 2390


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9942.47 Da        Isoelectric Point: 10.1206

>T277095 WP_001230709.1 NZ_CP122506:c35697-35443 [Escherichia coli]
MRKNKGRLTYYLEVIDKKYHFVKKISSYSKEFTDGKTKRTKRTLSELVFNESEVEAIDFTKNGLRPVDKNILLTMVKEYK
ESDA

Download         Length: 255 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9136.45 Da        Isoelectric Point: 7.2775

>AT277095 WP_000151456.1 NZ_CP122506:c35446-35204 [Escherichia coli]
MTIENTPENIKKLRKKIGLTQTECGEIFGVGLSTWQKKEAKTHNQLNLSKGEFEYLLLLAGEHPEYVLHKKAESRSPEEP

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3G9H8F0

Antitoxin

Source ID Structure
AlphaFold DB A0A3G9GNF5

References