Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 35833..36434 Replicon plasmid unnamed1
Accession NZ_CP122504
Organism Escherichia coli strain W619

Toxin (Protein)


Gene name doc Uniprot ID U9YA20
Locus tag QC808_RS23490 Protein ID WP_001216045.1
Coordinates 35833..36213 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag QC808_RS23495 Protein ID WP_001190712.1
Coordinates 36213..36434 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QC808_RS23465 31274..32758 - 1485 WP_167787821.1 terminase -
QC808_RS23470 32758..33951 - 1194 WP_160188011.1 terminase -
QC808_RS23475 34037..34489 - 453 WP_275340841.1 Late promoter-activating protein -
QC808_RS23480 34578..35621 - 1044 WP_284656449.1 DUF968 domain-containing protein -
QC808_RS23485 35649..35828 - 180 WP_000113019.1 hypothetical protein -
QC808_RS23490 35833..36213 - 381 WP_001216045.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QC808_RS23495 36213..36434 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QC808_RS23500 36507..36899 - 393 WP_000506718.1 S24 family peptidase -
QC808_RS23505 37011..37259 - 249 WP_097054259.1 DNA polymerase III subunit theta -
QC808_RS23510 37262..37528 - 267 WP_000946114.1 hypothetical protein -
QC808_RS23515 37598..38221 - 624 WP_000057454.1 hypothetical protein -
QC808_RS23520 38203..38577 - 375 WP_000988655.1 hypothetical protein -
QC808_RS23525 38584..38877 - 294 WP_284656500.1 hypothetical protein -
QC808_RS23530 39056..39289 - 234 WP_000517420.1 hypothetical protein -
QC808_RS23535 39366..39626 - 261 WP_033553819.1 hypothetical protein -
QC808_RS23540 39623..39988 - 366 WP_275340844.1 DUF551 domain-containing protein -
QC808_RS23545 40229..40363 - 135 Protein_51 hypothetical protein -
QC808_RS23550 40360..40569 - 210 WP_005025300.1 hypothetical protein -
QC808_RS23555 40571..41035 - 465 WP_023146892.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..101665 101665


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(3-120)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13588.29 Da        Isoelectric Point: 5.1514

>T277090 WP_001216045.1 NZ_CP122504:c36213-35833 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT277090 WP_001190712.1 NZ_CP122504:c36434-36213 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CLP7

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References