Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 35833..36434 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP122504 | ||
| Organism | Escherichia coli strain W619 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | U9YA20 |
| Locus tag | QC808_RS23490 | Protein ID | WP_001216045.1 |
| Coordinates | 35833..36213 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | QC808_RS23495 | Protein ID | WP_001190712.1 |
| Coordinates | 36213..36434 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QC808_RS23465 | 31274..32758 | - | 1485 | WP_167787821.1 | terminase | - |
| QC808_RS23470 | 32758..33951 | - | 1194 | WP_160188011.1 | terminase | - |
| QC808_RS23475 | 34037..34489 | - | 453 | WP_275340841.1 | Late promoter-activating protein | - |
| QC808_RS23480 | 34578..35621 | - | 1044 | WP_284656449.1 | DUF968 domain-containing protein | - |
| QC808_RS23485 | 35649..35828 | - | 180 | WP_000113019.1 | hypothetical protein | - |
| QC808_RS23490 | 35833..36213 | - | 381 | WP_001216045.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| QC808_RS23495 | 36213..36434 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QC808_RS23500 | 36507..36899 | - | 393 | WP_000506718.1 | S24 family peptidase | - |
| QC808_RS23505 | 37011..37259 | - | 249 | WP_097054259.1 | DNA polymerase III subunit theta | - |
| QC808_RS23510 | 37262..37528 | - | 267 | WP_000946114.1 | hypothetical protein | - |
| QC808_RS23515 | 37598..38221 | - | 624 | WP_000057454.1 | hypothetical protein | - |
| QC808_RS23520 | 38203..38577 | - | 375 | WP_000988655.1 | hypothetical protein | - |
| QC808_RS23525 | 38584..38877 | - | 294 | WP_284656500.1 | hypothetical protein | - |
| QC808_RS23530 | 39056..39289 | - | 234 | WP_000517420.1 | hypothetical protein | - |
| QC808_RS23535 | 39366..39626 | - | 261 | WP_033553819.1 | hypothetical protein | - |
| QC808_RS23540 | 39623..39988 | - | 366 | WP_275340844.1 | DUF551 domain-containing protein | - |
| QC808_RS23545 | 40229..40363 | - | 135 | Protein_51 | hypothetical protein | - |
| QC808_RS23550 | 40360..40569 | - | 210 | WP_005025300.1 | hypothetical protein | - |
| QC808_RS23555 | 40571..41035 | - | 465 | WP_023146892.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..101665 | 101665 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13588.29 Da Isoelectric Point: 5.1514
>T277090 WP_001216045.1 NZ_CP122504:c36213-35833 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CLP7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |