Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4284454..4285049 | Replicon | chromosome |
Accession | NZ_CP122503 | ||
Organism | Escherichia coli strain W619 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | U9Y4M4 |
Locus tag | QC808_RS20515 | Protein ID | WP_000239579.1 |
Coordinates | 4284454..4284804 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | U9Y2K1 |
Locus tag | QC808_RS20520 | Protein ID | WP_001223208.1 |
Coordinates | 4284798..4285049 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QC808_RS20495 (4279900) | 4279900..4280922 | - | 1023 | WP_001313531.1 | ABC transporter permease | - |
QC808_RS20500 (4280936) | 4280936..4282438 | - | 1503 | WP_021557471.1 | sugar ABC transporter ATP-binding protein | - |
QC808_RS20505 (4282578) | 4282578..4283534 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
QC808_RS20510 (4283844) | 4283844..4284374 | + | 531 | WP_000055072.1 | inorganic diphosphatase | - |
QC808_RS20515 (4284454) | 4284454..4284804 | - | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
QC808_RS20520 (4284798) | 4284798..4285049 | - | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
QC808_RS20525 (4285262) | 4285262..4285603 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
QC808_RS20530 (4285606) | 4285606..4289385 | - | 3780 | WP_021557470.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T277087 WP_000239579.1 NZ_CP122503:c4284804-4284454 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0Y8A8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LQ26 |