Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1893515..1894346 Replicon chromosome
Accession NZ_CP122503
Organism Escherichia coli strain W619

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QC808_RS09095 Protein ID WP_000854814.1
Coordinates 1893515..1893889 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B3Y195
Locus tag QC808_RS09100 Protein ID WP_001285585.1
Coordinates 1893978..1894346 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QC808_RS09055 (1888911) 1888911..1890077 + 1167 WP_000830156.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
QC808_RS09060 (1890196) 1890196..1890669 + 474 WP_001105415.1 DNA gyrase inhibitor SbmC -
QC808_RS09065 (1890867) 1890867..1891925 + 1059 WP_001200891.1 FUSC family protein -
QC808_RS09070 (1892097) 1892097..1892426 + 330 WP_000450409.1 DUF496 family protein -
QC808_RS09075 (1892527) 1892527..1892661 - 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
QC808_RS09080 (1892781) 1892781..1892909 + 129 Protein_1776 transposase domain-containing protein -
QC808_RS09085 (1893198) 1893198..1893278 - 81 Protein_1777 hypothetical protein -
QC808_RS09090 (1893324) 1893324..1893518 - 195 WP_000988600.1 DUF5983 family protein -
QC808_RS09095 (1893515) 1893515..1893889 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QC808_RS09100 (1893978) 1893978..1894346 - 369 WP_001285585.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QC808_RS09105 (1894420) 1894420..1894641 - 222 WP_000692323.1 DUF987 domain-containing protein -
QC808_RS09110 (1894704) 1894704..1895180 - 477 WP_001186726.1 RadC family protein -
QC808_RS09115 (1895196) 1895196..1895675 - 480 WP_000860087.1 antirestriction protein -
QC808_RS09120 (1895757) 1895757..1896575 - 819 WP_001234629.1 DUF932 domain-containing protein -
QC808_RS09125 (1896675) 1896675..1896908 - 234 WP_001119729.1 DUF905 family protein -
QC808_RS09130 (1896987) 1896987..1897441 - 455 Protein_1786 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T277078 WP_000854814.1 NZ_CP122503:c1893889-1893515 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13593.48 Da        Isoelectric Point: 6.3139

>AT277078 WP_001285585.1 NZ_CP122503:c1894346-1893978 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LW60

References