Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1056328..1056911 | Replicon | chromosome |
Accession | NZ_CP122503 | ||
Organism | Escherichia coli strain W619 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | U9XFN8 |
Locus tag | QC808_RS05125 | Protein ID | WP_000254745.1 |
Coordinates | 1056576..1056911 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A1M2U551 |
Locus tag | QC808_RS05120 | Protein ID | WP_021557150.1 |
Coordinates | 1056328..1056576 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QC808_RS05110 (1052667) | 1052667..1053968 | + | 1302 | WP_021557151.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
QC808_RS05115 (1054016) | 1054016..1056250 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
QC808_RS05120 (1056328) | 1056328..1056576 | + | 249 | WP_021557150.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
QC808_RS05125 (1056576) | 1056576..1056911 | + | 336 | WP_000254745.1 | endoribonuclease MazF | Toxin |
QC808_RS05130 (1056982) | 1056982..1057773 | + | 792 | WP_001071643.1 | nucleoside triphosphate pyrophosphohydrolase | - |
QC808_RS05135 (1058001) | 1058001..1059638 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
QC808_RS05140 (1059726) | 1059726..1061024 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12158.08 Da Isoelectric Point: 8.4777
>T277076 WP_000254745.1 NZ_CP122503:1056576-1056911 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XYM3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M2U551 |