Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 90575..91218 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP122500 | ||
| Organism | Escherichia coli strain W409 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | V0UN72 |
| Locus tag | QC809_RS24115 | Protein ID | WP_001034044.1 |
| Coordinates | 90802..91218 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | B1P7N7 |
| Locus tag | QC809_RS24110 | Protein ID | WP_001261286.1 |
| Coordinates | 90575..90805 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QC809_RS24090 (87206) | 87206..87961 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| QC809_RS24095 (88683) | 88683..89489 | - | 807 | WP_000016970.1 | site-specific integrase | - |
| QC809_RS24100 (89490) | 89490..89795 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | - |
| QC809_RS24105 (89797) | 89797..90015 | - | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | - |
| QC809_RS24110 (90575) | 90575..90805 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QC809_RS24115 (90802) | 90802..91218 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QC809_RS24120 (91293) | 91293..92858 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
| QC809_RS24125 (92843) | 92843..93370 | + | 528 | Protein_122 | DNA helicase UvrD | - |
| QC809_RS24135 (94187) | 94187..95044 | - | 858 | WP_000968139.1 | iron/manganese ABC transporter permease subunit SitD | - |
| QC809_RS24140 (95041) | 95041..95898 | - | 858 | WP_001101728.1 | iron/manganese ABC transporter permease subunit SitC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | floR / sitABCD / aac(6')-Ib-cr / blaOXA-1 / catB3 / ARR-3 / qacE / sul1 / mph(A) / erm(B) | - | 1..135934 | 135934 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T277068 WP_001034044.1 NZ_CP122500:90802-91218 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CHW1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CKZ6 |