Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 90575..91218 Replicon plasmid unnamed1
Accession NZ_CP122500
Organism Escherichia coli strain W409

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag QC809_RS24115 Protein ID WP_001034044.1
Coordinates 90802..91218 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag QC809_RS24110 Protein ID WP_001261286.1
Coordinates 90575..90805 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QC809_RS24090 (87206) 87206..87961 - 756 WP_000852146.1 replication initiation protein RepE -
QC809_RS24095 (88683) 88683..89489 - 807 WP_000016970.1 site-specific integrase -
QC809_RS24100 (89490) 89490..89795 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -
QC809_RS24105 (89797) 89797..90015 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA -
QC809_RS24110 (90575) 90575..90805 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QC809_RS24115 (90802) 90802..91218 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
QC809_RS24120 (91293) 91293..92858 + 1566 WP_001128474.1 AAA family ATPase -
QC809_RS24125 (92843) 92843..93370 + 528 Protein_122 DNA helicase UvrD -
QC809_RS24135 (94187) 94187..95044 - 858 WP_000968139.1 iron/manganese ABC transporter permease subunit SitD -
QC809_RS24140 (95041) 95041..95898 - 858 WP_001101728.1 iron/manganese ABC transporter permease subunit SitC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid floR / sitABCD / aac(6')-Ib-cr / blaOXA-1 / catB3 / ARR-3 / qacE / sul1 / mph(A) / erm(B) - 1..135934 135934


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T277068 WP_001034044.1 NZ_CP122500:90802-91218 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT277068 WP_001261286.1 NZ_CP122500:90575-90805 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References