Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 89490..90015 Replicon plasmid unnamed1
Accession NZ_CP122500
Organism Escherichia coli strain W409

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag QC809_RS24100 Protein ID WP_001159871.1
Coordinates 89490..89795 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag QC809_RS24105 Protein ID WP_000813630.1
Coordinates 89797..90015 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QC809_RS24085 (85452) 85452..86618 - 1167 WP_000772446.1 plasmid-partitioning protein SopA -
QC809_RS24090 (87206) 87206..87961 - 756 WP_000852146.1 replication initiation protein RepE -
QC809_RS24095 (88683) 88683..89489 - 807 WP_000016970.1 site-specific integrase -
QC809_RS24100 (89490) 89490..89795 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
QC809_RS24105 (89797) 89797..90015 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
QC809_RS24110 (90575) 90575..90805 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
QC809_RS24115 (90802) 90802..91218 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -
QC809_RS24120 (91293) 91293..92858 + 1566 WP_001128474.1 AAA family ATPase -
QC809_RS24125 (92843) 92843..93370 + 528 Protein_122 DNA helicase UvrD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid floR / sitABCD / aac(6')-Ib-cr / blaOXA-1 / catB3 / ARR-3 / qacE / sul1 / mph(A) / erm(B) - 1..135934 135934


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T277067 WP_001159871.1 NZ_CP122500:c89795-89490 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT277067 WP_000813630.1 NZ_CP122500:c90015-89797 [Escherichia coli]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References