Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1902968..1903803 | Replicon | chromosome |
| Accession | NZ_CP122499 | ||
| Organism | Escherichia coli strain W409 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | QC809_RS09360 | Protein ID | WP_042046912.1 |
| Coordinates | 1902968..1903345 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | QC809_RS09365 | Protein ID | WP_135145692.1 |
| Coordinates | 1903435..1903803 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QC809_RS09325 (1898488) | 1898488..1898961 | + | 474 | WP_001105407.1 | DNA gyrase inhibitor SbmC | - |
| QC809_RS09330 (1899159) | 1899159..1900217 | + | 1059 | WP_001200895.1 | FUSC family protein | - |
| QC809_RS09335 (1900389) | 1900389..1900718 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| QC809_RS09340 (1900819) | 1900819..1901184 | - | 366 | WP_001280455.1 | EutP/PduV family microcompartment system protein | - |
| QC809_RS09345 (1901455) | 1901455..1901826 | - | 372 | WP_001295631.1 | IS110 family transposase | - |
| QC809_RS09350 (1902642) | 1902642..1902722 | - | 81 | Protein_1829 | hypothetical protein | - |
| QC809_RS09355 (1902822) | 1902822..1902971 | - | 150 | Protein_1830 | DUF5983 family protein | - |
| QC809_RS09360 (1902968) | 1902968..1903345 | - | 378 | WP_042046912.1 | TA system toxin CbtA family protein | Toxin |
| QC809_RS09365 (1903435) | 1903435..1903803 | - | 369 | WP_135145692.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QC809_RS09370 (1903966) | 1903966..1904187 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QC809_RS09375 (1904250) | 1904250..1904726 | - | 477 | WP_001186774.1 | RadC family protein | - |
| QC809_RS09380 (1904742) | 1904742..1905215 | - | 474 | WP_000855059.1 | antirestriction protein | - |
| QC809_RS09385 (1905557) | 1905557..1906375 | - | 819 | WP_087523595.1 | DUF932 domain-containing protein | - |
| QC809_RS09390 (1906493) | 1906493..1906688 | - | 196 | Protein_1837 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14020.96 Da Isoelectric Point: 7.8276
>T277051 WP_042046912.1 NZ_CP122499:c1903345-1902968 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13545.30 Da Isoelectric Point: 6.4764
>AT277051 WP_135145692.1 NZ_CP122499:c1903803-1903435 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPHHQHTVTLYAKGLTCEADTLGSCGYAYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPHHQHTVTLYAKGLTCEADTLGSCGYAYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|