Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 772734..773532 Replicon chromosome
Accession NZ_CP122499
Organism Escherichia coli strain W409

Toxin (Protein)


Gene name yeeV Uniprot ID U9XMP3
Locus tag QC809_RS03840 Protein ID WP_000854735.1
Coordinates 772734..773111 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A1M1EW42
Locus tag QC809_RS03845 Protein ID WP_032153712.1
Coordinates 773158..773532 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QC809_RS03810 (768699) 768699..769964 - 1266 WP_001218862.1 integrase arm-type DNA-binding domain-containing protein -
QC809_RS03815 (770428) 770428..770754 - 327 WP_000779483.1 type II toxin-antitoxin system RelE/ParE family toxin -
QC809_RS03820 (770751) 770751..771014 - 264 WP_025492088.1 type II toxin-antitoxin system ParD family antitoxin -
QC809_RS03825 (771086) 771086..771952 - 867 WP_032153714.1 DUF4942 domain-containing protein -
QC809_RS03830 (772037) 772037..772234 - 198 WP_000839265.1 DUF957 domain-containing protein -
QC809_RS03835 (772246) 772246..772737 - 492 WP_023155722.1 DUF5983 family protein -
QC809_RS03840 (772734) 772734..773111 - 378 WP_000854735.1 TA system toxin CbtA family protein Toxin
QC809_RS03845 (773158) 773158..773532 - 375 WP_032153712.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QC809_RS03850 (773612) 773612..773833 - 222 WP_000692345.1 DUF987 domain-containing protein -
QC809_RS03855 (773902) 773902..774378 - 477 WP_001186715.1 RadC family protein -
QC809_RS03860 (774394) 774394..774879 - 486 WP_032153711.1 antirestriction protein -
QC809_RS03865 (774971) 774971..775789 - 819 WP_001234693.1 DUF932 domain-containing protein -
QC809_RS03870 (775880) 775880..776089 - 210 WP_023155727.1 DUF905 family protein -
QC809_RS03875 (776119) 776119..776796 - 678 WP_023155728.1 hypothetical protein -
QC809_RS03880 (776915) 776915..777799 - 885 WP_024166630.1 50S ribosome-binding GTPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR papI / papB 770428..837909 67481


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14061.07 Da        Isoelectric Point: 8.2904

>T277047 WP_000854735.1 NZ_CP122499:c773111-772734 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13697.51 Da        Isoelectric Point: 6.6240

>AT277047 WP_032153712.1 NZ_CP122499:c773532-773158 [Escherichia coli]
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYMAVYPTLAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9XMP3

Antitoxin

Source ID Structure
AlphaFold DB A0A1M1EW42

References